Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5M9 Olfactory Receptor

Gene Symbol OR5M91 (View this gene in GeneCards)
Family 5
Subfamily M
Pseudogene No
CORP pseudogene probability score 0.51 (pseudogene)
Aliases OR11-190, HsOR11.11.69, ORL3384
External Ids HGNC: 15294   GeneBank: AB065747, AF399519, BK004497, NM_001004743   ORDB: ORL3384   
Build #39 labels OR5M9
Chromosomal location 11:56,462,472-56,463,401 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5M3 76.8% 306
OR5M4P 75.24% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5M9 94% 305
Chimp CONTIG*********** 98% 310
Mouse Or5m9 90% 310
Mouse Or5m9b 89% 310
Rat Or5m9 90% 310
Cow OR5M9 91% 310
Cow OR5M9DP 87% 305
Cow OR5M9HP 85% 310
Cow OR5M9GP 83% 308
Cow OR5M9KP 84% 303
Cow OR5M9EP 85% 305
Cow OR5M9JP 83% 310

Expression evidences

Source Accession
mRNA BC140458

Sequence information

Nucleotide sequence ATGCCTAATTTCACGGATGTGACAGAATTTACTCTCCTGGGGCTGACCTGTCGTCAGGAG
CTACAGGTTCTCTTTTTTGTGGTGTTCCTAGCGGTTTACATGATCACTCTGTTGGGAAAT
ATTGGTATGATCATTTTGATTAGCATCAGTCCTCAGCTTCAGAGTCCCATGTACTTTTTC
CTGAGTCATCTGTCTTTTGCGGACGTGTGCTTCTCCTCCAACGTTACCCCCAAAATGCTG
GAAAACTTATTATCAGAGACAAAAACCATTTCCTATGTGGGATGCTTGGTGCAGTGCTAC
TTTTTCATTGCCGTTGTCCACGTGGAGGTCTATATCCTGGCTGTGATGGCCTTTGACAGG
TACATGGCCGGCTGCAACCCTCTGCTTTATGGCAGTAAAATGTCTAGGACTGTGTGTGTT
CGGCTCATCTCTGTGCCTTATGTCTATGGATTCTCTGTCAGCCTAATATGCACACTATGG
ACTTATGGCTTATACTTCTGTGGAAACTTTGAAATCAATCACTTCTATTGTGCAGATCCC
CCTCTCATCCAGATTGCCTGTGGGAGAGTGCACATCAAAGAAATCACAATGATTGTTATT
GCTGGAATTAACTTCACATATTCCCTCTCGGTGGTCCTCATCTCCTACACTCTCATTGTA
GTAGCTGTGCTACGCATGCGCTCTGCCGATGGCAGGAGGAAGGCGTTCTCCACCTGTGGG
TCCCACTTGACGGCTGTTTCTATGTTTTATGGGACCCCCATCTTCATGTATCTCAGGAGA
CCCACTGAGGAATCCGTAGAGCAGGGCAAAATGGTGGCTGTGTTTTACACCACAGTAATT
CCTATGTTGAATCCCATGATCTACAGTCTGAGAAATAAGGATGTAAAAGAAGCAGTCAAC
AAAGCAATCACCAAGACATATGTGAGGCAG
Conceptual translation MPNFTDVTEFTLLGLTCRQELQVLFFVVFLAVYMITLLGNIGMIILISISPQLQSPMYFF
LSHLSFADVCFSSNVTPKMLENLLSETKTISYVGCLVQCYFFIAVVHVEVYILAVMAFDR
YMAGCNPLLYGSKMSRTVCVRLISVPYVYGFSVSLICTLWTYGLYFCGNFEINHFYCADP
PLIQIACGRVHIKEITMIVIAGINFTYSLSVVLISYTLIVVAVLRMRSADGRRKAFSTCG
SHLTAVSMFYGTPIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAVN
KAITKTYVRQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A P/L 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN A/G S/S 1000GP (YRI)
11 56,230,069 56,230,069 NS T/C K/R rs1945237 (DbSNP)
11 56,230,120 56,230,120 NS A/G L/P rs61902868 (DbSNP)
11 56,230,328 56,230,328 NS G/T Q/K rs61902869 (DbSNP)
11 56,230,473 56,230,473 SYN A/G S/S rs61902870 (DbSNP)
11 56,230,678 56,230,678 NS A/G V/A rs61902871 (DbSNP)
11 56,462,593 56,462,593 NS T/C K/R 1000GP (CEU)
11 56,462,644 56,462,644 NS G/A P/L 1000GP (CEU)
11 56,462,769 56,462,769 SYN C/T V/V 1000GP (CEU)
11 56,462,852 56,462,852 NS G/T Q/K 1000GP (CEU)
11 56,462,997 56,462,997 SYN A/G S/S 1000GP (CEU)
11 56,463,135 56,463,135 SYN G/T T/T 1000GP (CEU)
11 56,463,202 56,463,202 NS G/A A/V 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 121 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L290M K270R T262S P253L L209V N204D C187Y Q184K S154C G124D V97M A67V % Freq CORP
1 L K T P L N C Q S G V A 86.18 0.250
2 L R T L L N C K S G V V 4.53 0.250
3 L K T L L N C K S G V V 3.92 0.250
4 L K T P L N C Q S G V V 3.07 0.250
5 L K T P L D C Q S G V V 0.54 0.250
6 M K T P L N C Q S G V A 0.31 0.250
7 L K T P L N Y Q S G V V 0.31 0.257
8 L K T P L N C Q C G V A 0.15 0.250
9 L K T L L N C K S G V A 0.15 0.250
10 L K T P L N C Q S G M A 0.15 0.250
11 L K T P V N C Q S G V A 0.15 0.250
12 L R T L L N C K S G V A 0.15 0.250
13 L K T P L D C Q S G V A 0.08 0.250
14 L R T P L N C Q S D V A 0.08 0.250
15 L R T P L N C Q S G V A 0.08 0.250
16 L K S P L N C Q S G V A 0.08 0.250
17 L R T P L N C K S G V V 0.08 0.250

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5M9.aApr07-unspliced main_exon 3UTR chr11 56,462,469 56,462,472 -
CDS chr11 56,462,472 56,463,401 -