Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5T2 Olfactory Receptor

Gene Symbol OR5T21 (View this gene in GeneCards)
Family 5
Subfamily T
Pseudogene No
CORP pseudogene probability score 0.18 (functional)
Aliases OR11-177, HsOR11.11.54, ORL3296
External Ids HGNC: 15296   GeneBank: AB065838, BK004334, NM_001004746   ORDB: ORL3296   
Build #39 labels OR5T2
Chromosomal location 11:56,232,109-56,233,062 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5T1 76.92% 312
OR5T3 77.81% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5T2 84% 306
Dog OR5T2B 83% 311
Chimp CONTIG229.1-7562 97% 318
Mouse Or5t15 75% 306
Rat Or5t7 75% 308
Cow OR5T1 77% 308

Expression evidences

Source Accession
mRNA BC136876
GNF Atlas2 gnf1h11079_at

Sequence information

Nucleotide sequence ATGAAGAATGTCACTGAAGTTACCTTATTTGTACTGAAGGGCTTCACAGACAATCTTGAA
CTGCAGACTATCTTCTTCTTCCTGTTTCTAGCAATCTACCTCTTCACTCTCATGGGAAAT
TTAGGACTGATTTTAGTGGTCATTAGGGATTCCCAGCTCCACAAACCCATGTACTATTTT
CTGAGTATGTTGTCTTCTGTGGATGCCTGCTATTCCTCAGTTATTACCCCAAATATGTTA
GTAGATTTTACGACAAAGAATAAAGTCATTTCATTCCTTGGATGTGTAGCACAGGTGTTT
CTTGCTTGTAGTTTTGGAACCACAGAATGCTTTCTCTTGGCTGCAATGGCTTATGATCGC
TATGTAGCCATCTACAACCCTCTCCTGTATTCAGTGAGCATGTCACCCAGAGTCTACATG
CCACTCATCAATGCTTCCTATGTTGCTGGCATTTTACATGCTACTATACATACAGTGGCT
ACATTTAGCCTATCCTTCTGTGGAGCCAATGAAATTAGGCGTGTCTTTTGTGATATCCCT
CCTCTCCTTGCTATTTCTTATTCTGACACTCACACAAACCAGCTTCTACTCTTCTACTTT
GTGGGCTCTATCGAGCTGGTCACTATCCTGATTGTTCTGATCTCCTATGGTTTGATTCTG
TTGGCCATTCTGAAGATGTATTCTGCTGAAGGGAGGAGAAAAGTCTTCTCCACATGTGGA
GCTCACCTAACTGGAGTGTCAATTTATTATGGGACAATCCTCTTCATGTATGTGAGACCA
AGTTCCAGCTATGCTTCGGACCATGACATGATAGTGTCAATATTTTACACCATTGTGATT
CCCTTGCTGAATCCCGTCATCTACAGTTTGAGGAACAAAGATGTAAAAGACTCAATGAAA
AAAATGTTTGGGAAAAATCAGGTTATCAATAAAGTATATTTTCATACTAAAAAA
Conceptual translation MKNVTEVTLFVLKGFTDNLELQTIFFFLFLAIYLFTLMGNLGLILVVIRDSQLHKPMYYF
LSMLSSVDACYSSVITPNMLVDFTTKNKVISFLGCVAQVFLACSFGTTECFLLAAMAYDR
YVAIYNPLLYSVSMSPRVYMPLINASYVAGILHATIHTVATFSLSFCGANEIRRVFCDIP
PLLAISYSDTHTNQLLLFYFVGSIELVTILIVLISYGLILLAILKMYSAEGRRKVFSTCG
AHLTGVSIYYGTILFMYVRPSSSYASDHDMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMK
KMFGKNQVINKVYFHTKK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/C H/D 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A L/L 1000GP (YRI)
11 55,999,737 55,999,737 NS C/G D/H rs7121880 (DbSNP)
11 55,999,897 55,999,897 SYN A/G I/I rs7122000 (DbSNP)
11 55,999,950 55,999,950 NS C/G V/L rs12221615 (DbSNP)
11 56,000,063 56,000,063 NS A/C V/G rs34616155 (DbSNP)
11 56,000,066 56,000,066 NS G/A T/I rs62621278 (DbSNP)
11 56,000,288 56,000,288 NS A/G M/T rs7122514 (DbSNP)
11 56,000,403 56,000,403 NS C/G V/L rs10791893 (DbSNP)
11 56,000,451 56,000,451 SYN A/G L/L rs11227598 (DbSNP)
11 56,000,471 56,000,471 NS A/G I/T rs11227599 (DbSNP)
11 56,232,202 56,232,202 SYN G/T I/I 1000GP (CHBJPT)
11 56,232,261 56,232,261 NS G/C H/D 1000GP (CEU)
11 56,232,421 56,232,421 SYN G/A I/I 1000GP (CEU)
11 56,232,474 56,232,474 NS G/C L/V 1000GP (CEU, CHBJPT)
11 56,232,590 56,232,590 NS G/A T/I 1000GP (CEU)
11 56,232,603 56,232,603 NS C/T A/T 1000GP (CEU)
11 56,232,812 56,232,812 NS G/A T/M 1000GP (CEU)
11 56,232,927 56,232,927 NS C/G V/L 1000GP (CEU)
11 56,232,975 56,232,975 SYN G/A L/L 1000GP (CEU, CHBJPT)
11 56,232,995 56,232,995 NS G/A T/I 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

H309D L238V S229F T199I A195T T125M V87L T64I % Freq CORP
1 H L S T A T L T 68.97 0.940
2 H L S T A T V T 10.37 0.940
3 H V S T A T L I 9.45 0.940
4 D L S T A M L I 4.84 0.940
5 H L S I A T L T 2.07 0.940
6 D L S T A T L I 1.92 0.940
7 H L S T T T L T 1.08 0.940
8 H L S T A T L I 0.77 0.940
9 D L F T A T L I 0.31 0.940
10 H V S T A M L T 0.08 0.940
11 D L S T A T L T 0.08 0.940
12 H L S T A M V T 0.08 0.940

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5T2.aApr07-unspliced main_exon 3UTR chr11 56,232,106 56,232,109 -
CDS chr11 56,232,109 56,233,062 -
5UTR chr11 56,233,062 56,233,185 -