Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6B2 Olfactory Receptor

Gene Symbol OR6B21 (View this gene in GeneCards)
Family 6
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.31 (functional)
Aliases OR2-1, HsOR2.4.1
External Ids HGNC: 15041   GeneBank: AB065663, BC065821, BK004288, NM_001005853   
Build #39 labels OR6B2P
Chromosomal location 2:240,029,494-240,030,429 (-)
Cluster 2@241
Synteny CLIC#7
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6B3 95.44% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6B2 84% 309
Dog OR6B2C 83% 312
Dog OR6B2D 83% 309
Chimp CONTIG1089.72-11320 94% 307
Chimp CONTIG1089.75-187 99% 208
Mouse Or6b3 88% 309
Mouse Or6b2 86% 312
Mouse Or6b2b 86% 310
Rat Or6b3 88% 310
Rat Or6b2b 86% 310
Rat Or6b2 86% 309
Cow OR6B2 86% 303
Cow OR6B3 83% 311

Expression evidences

Source Accession
ESTs BQ893658
mRNA BC137562
GNF Atlas2 gnf1h05804_at

Sequence information

Nucleotide sequence ATGAGTGGGGAGAATGTCACCAAGGTCAGCACCTTCATCCTGGTGGGCCTCCCCACGGCC
CCAGGGCTGCAGTACCTGCTCTTCCTCCTCTTCCTGCTCACCTACCTCTTTGTCCTGGTG
GAGAACCTGGCCATCATCCTCATCGTCTGGAGCAGCACCTCCCTCCACAGGCCCATGTAC
TACTTTCTGAGCTCCATGTCTTTCCTGGAGATCTGGTACGTGTCTGACATCACCCCCAAG
ATGCTGGAGGGCTTCCTCCTCCAGCAGAAACGCATCTCTTTCGTCGGGTGCATGACGCAG
CTCTACTTCTTCAGCTCCCTGGTGTGCACCGAGTGTGTGCTTCTGGCCTCCATGGCCTAC
GACCGCTACGTGGCCATCTGCCACCCGCTGCGCTACCACGTCCTTGTGACCCCGGGGCTG
TGCCTCCAGCTGGTGGGCTTCTCCTTTGTGAGTGGCTTCACCATCTCCATGATCAAGGTC
TGTTTTATCTCCAGCGTCACGTTCTGTGGCTCCAACGTCTTGAACCACTTCTTCTGTGAC
ATTTCCCCCATCCTCAAGCTGGCCTGCACGGACTTCTCCACTGCAGAGCTGGTGGATTTC
ATCCTGGCCTTCATCATCCTGGTGTTTCCGCTCCTGGCCACCATACTGTCATATTGGCAC
ATCACCCTGGCTGTCCTGCGCATCCCCTCGGCCACCGGCTGCTGGAGAGCCTTCTCTACC
TGCGCCTCTCACCTCACCGTGGTCACCGTCTTCTATACAGCCTTGCTTTTCATGTATGTC
CGGCCCCAAGCCATTGATTCCCAGAGCTCCAACAAGCTCATCTCTGCCGTGTACACTGTT
GTCACGCCAATAATTAACCCTTTGATTTACTGCCTGAGGAACAAGGAATTTAAGGACGCC
TTGAAAAAGGCCTTGGGCTTGGGTCAAACTTCACAC
Conceptual translation MSGENVTKVSTFILVGLPTAPGLQYLLFLLFLLTYLFVLVENLAIILIVWSSTSLHRPMY
YFLSSMSFLEIWYVSDITPKMLEGFLLQQKRISFVGCMTQLYFFSSLVCTECVLLASMAY
DRYVAICHPLRYHVLVTPGLCLQLVGFSFVSGFTISMIKVCFISSVTFCGSNVLNHFFCD
ISPILKLACTDFSTAELVDFILAFIILVFPLLATILSYWHITLAVLRIPSATGCWRAFST
CASHLTVVTVFYTALLFMYVRPQAIDSQSSNKLISAVYTVVTPIINPLIYCLRNKEFKDA
LKKALGLGQTSH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
2 240,969,168 240,969,168 NS A/G C/R rs60841887 (DbSNP)
2 240,969,312 240,969,312 NS A/G C/R rs10187574 (DbSNP)
2 240,969,456 240,969,456 NS A/G C/R rs73107456 (DbSNP)
2 240,969,704 240,969,704 NS A/G I/T rs62617786 (DbSNP)
2 240,969,044 240,969,044 NS A/T L/Q rs61730693 (DbSNP)
2 240,969,012 240,969,012 NS C/T A/T rs61730689 (DbSNP)
2 240,969,198 240,969,198 NS G/A P/S rs61730687 (DbSNP)
2 240,969,179 240,969,179 NS G/A P/L rs61730686 (DbSNP)
2 240,969,837 240,969,837 NS T/C K/E rs61730683 (DbSNP)
2 240,969,340 240,969,340 SYN A/G C/C rs10187585 (DbSNP)
2 240,969,367 240,969,367 SYN C/G V/V rs73107432 (DbSNP)
2 240,969,244 240,969,244 SYN G/A I/I rs61730688 (DbSNP)
2 240,029,762 240,029,762 NS A/G L/P 1000GP (CEU)
2 240,029,765 240,029,765 NS G/A T/I 1000GP (CHBJPT)
2 100 -100 NS T/A Q/L 1000GP (YRI)
2 100 -100 SYN C/T K/K 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
2 240,911,276 241,082,695 CopyNumber Variation_0031 (DGV)
CopyNumber 120 (Hasin)
2 240,969,805 240,970,032 Del(-19) #2(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T279A Q268L R227C L223P T222I S217P E4K % Freq CORP
1 T Q R L T S E 95.47 0.447
2 T L R L T S E 1.38 0.447
3 T Q C L T S K 1.23 0.447
4 T Q R L I S E 1.08 0.447
5 T Q R P T S E 0.38 0.447
6 A Q R L T S E 0.31 0.447
7 T Q R L T P E 0.15 0.705

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6B2.aApr07 main_exon 3UTR chr2 240,028,966 240,029,494 -
CDS chr2 240,029,494 240,030,429 -
5UTR chr2 240,030,429 240,030,454 -
exon_5UTR chr2 240,032,893 240,032,913 -