Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6C1 Olfactory Receptor

Gene Symbol OR6C11 (View this gene in GeneCards)
Family 6
Subfamily C
Pseudogene No
CORP pseudogene probability score
Aliases OST267, HsOR12.5.11, ORL3815
External Ids HGNC: 8355   GeneBank: AF399506, NM_001005182   ORDB: ORL3815   
Build #39 labels OR6C1
Chromosomal location 12:55,320,600-55,321,535 (+)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6C3 74.76% 309
OR6C75 71.1% 308
OR6C7P 70.1% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6C1 82% 311
Dog OR6C1L 82% 311
Dog OR6C1K 81% 311
Dog OR6C1MP 80% 311
Chimp CONTIG802.61-16852 97% 312
Mouse Or6c1 85% 311
Mouse Or6c1b 84% 311
Rat Or6c1i 83% 309
Rat Or6c1 83% 309
Rat Or6c1h 81% 312
Rat Or6c1f-ps 80% 311
Cow OR6C1 87% 308
Cow OR6C1N 80% 311
Cow OR6C1Q 81% 310
Cow OR6C1P 80% 311
Cow OR6C1R 81% 308

Expression evidences

Source Accession
mRNA BC136965

Sequence information

Nucleotide sequence ATGAGAAACCATACAGAAATAACAGAGTTTATTCTTCTGGGATTAACAGATGACCCAAAT
TTTCAGGTTGTAATCTTTGTCTTCCTGCTCATCACCTACATGCTCAGCATCACTGGGAAC
CTGACCCTTATCACAATTACCCTGCTGGATTCCCACCTGCAGACCCCCATGTATTTCTTC
CTCAGAAATTTCTCCATATTAGAAATTTCGTTCACAACCGTCAGTATACCCAAGTTTCTG
GGTAACATTATTTCAGGAGATAAAACCATTTCCTTTAATAATTGCATAGTTCAGTTATTT
TTCTTCATTCTCTTGGGAGTCACAGAGTTTTACCTTCTGGCTGCCATGTCCTATGACCGC
TATGTGGCCATCTGCAAGCCTCTGCATTGCTTGAGTATCATGAATCGAAGAGTCTGCACA
CTGCTTGTTTTTACTTCTTGGCTGGTTTCATTCTTAATCATATTCCCAGCACTCATGTTG
CTTTTAAAGCTTCATTACTGTAGGTCTAATATTATTGACCATTTTACCTGTGATTATTTT
CCACTGCTGCAACTTGCTTGTTCAGACACAAAATTCTTAGAGGTGATGGGATTTTCTTGT
GCTGCGTTTACTCTAATGTTCACTTTGGCATTAATATTTCTGTCCTACATATACATTATC
AGAACAATTTTGAGAATTCCTTCTACTAGTCAGAGGACAAAGGCCTTTTCCACATGTTCT
TCCCACATGGTTGTTGTCTCCATCTCTTATGGCAGCTGCATTTTTATGTACATTAAACCC
TCAGCAAAAGATAGAGTGTCCTTGAGCAAGGGAGTGGCAATACTAAACACCTCAGTAGCC
CCCATGATGAACCCCTTTATTTACAGCCTAAGAAATCAGCAAGTCAAGCAAGCTTTCATT
AACATGGCAAGGAAGACTGTATTTTTCACAAGCACA
Conceptual translation MRNHTEITEFILLGLTDDPNFQVVIFVFLLITYMLSITGNLTLITITLLDSHLQTPMYFF
LRNFSILEISFTTVSIPKFLGNIISGDKTISFNNCIVQLFFFILLGVTEFYLLAAMSYDR
YVAICKPLHCLSIMNRRVCTLLVFTSWLVSFLIIFPALMLLLKLHYCRSNIIDHFTCDYF
PLLQLACSDTKFLEVMGFSCAAFTLMFTLALIFLSYIYIIRTILRIPSTSQRTKAFSTCS
SHMVVVSISYGSCIFMYIKPSAKDRVSLSKGVAILNTSVAPMMNPFIYSLRNQQVKQAFI
NMARKTVFFTST

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 100 -100 NS G/A V/I 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
12 55,320,988 55,320,988 NS G/A C/Y 1000GP (CEU, CHBJPT)
12 55,321,092 55,321,092 NS C/G H/D 1000GP (CEU, CHBJPT)
12 55,321,264 55,321,264 NS C/T T/I 1000GP (CEU)
12 55,321,335 55,321,335 NS G/A V/I 1000GP (CEU, CHBJPT)
12 55,714,407 55,714,406 Ins(1) -/A rs5798345 (DbSNP)
12 55,714,408 55,714,407 Ins(1) -/A rs35291292 (DbSNP)
12 55,714,772 55,714,772 NS A/G Y/C rs7132431 (DbSNP)
12 55,714,876 55,714,876 NS C/G H/D rs7132347 (DbSNP)
12 55,715,048 55,715,048 NS C/T T/I rs7132600 (DbSNP)
12 55,715,119 55,715,119 NS A/G I/V rs7132916 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
12 55,709,667 55,725,440 CopyNumber Variation_0429 (DGV)
12 55,714,284 55,717,319 CopyNumber #88 (Waszak)
12 55,714,876 55,725,690 CopyNumber Variation_1912 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V74I C130Y L161F H165D C200S T222I M243T V246I R291K S311R % Freq CORP
1 V Y L D C T M I R S 63.44 0.212
2 V C L H C T M V R S 18.82 1.000
3 V Y L D C I M I R S 13.13 0.212
4 V Y L D C T M I R R 1.61 0.212
5 I Y L D C T M I R S 1.00 0.212
6 I Y F D C T M I K S 0.54 0.212
7 V C L D C T M I R S 0.46 1.000
8 V C L H C T M I R S 0.46 1.000
9 V Y L D C T M V R S 0.23 0.128
10 V Y L D S T M I R S 0.15 0.212
11 V C L H C T T V R S 0.08 1.000
12 V C L D C I M I R S 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6C1.aApr07-unspliced main_exon CDS chr12 55,320,600 55,321,535 +
3UTR chr12 55,321,535 55,321,538 +