Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6C65 Olfactory Receptor

Gene Symbol OR6C651 (View this gene in GeneCards)
Family 6
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.92 (pseudogene)
Aliases HsOR12.5.17
External Ids HGNC: 31295   GeneBank: NM_001005518   
Build #39 labels
Chromosomal location 12:55,400,529-55,401,464 (+)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6C66P 76.62% 308
OR6C75 72.76% 312
OR6C76 74.36% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6C75C 71% 306
Chimp CONTIG*********** 69% 298
Chimp CONTIG*********** 67% 312
Chimp CONTIG*********** 66% 309
Mouse Or6c65 83% 312
Rat Or6c65-ps 76% 312
Cow OR6C76 75% 308

Expression evidences

Source Accession
mRNA BC136899

Sequence information

Nucleotide sequence ATGCCAAATATGACATCAATTAGAGAATTCATTCTTCTGGGATTTACAGATAACCCAGAG
TTACAAGTTGTGATATTCTTCTTTATGTTGATCACATACTTATTGAGTGTAAGTGGAAAC
ATGATCATCATTATGTTAACATTGTCAAATATTCATTTGAAAACTCCTATGTATTTCTTC
CTCAGGAATTTCTCTTTCTTAGAAATTTCATTTACGACAGTCTTCATTCCTAGATTTCTG
ATCAACATTGCTACAGGAGACACAACCATTTCCTATAATGCTTCCATGGCCCAAGTATTT
TTTTTAATTCTTTTGGGATCAACAGAATTTTTTCTTCTGGCTGTCATGTCTTATGATCGC
TATGTGGCTATCTGCAAACCTCTACATTATACAACCATCATGAGTAACAAAGTCTGTAAT
TGGCTTGTAATCAGCTCCTGGCTGGCTGGTTTTCTCATTATTTTTCCCCCCGTGATTATG
GGCCTCCAACTGGATTTTTGTGACTCCAGCACTATTGACCATTTCATCTGTGATTCTTCC
CCTATGCTGCTGATTGCTTGCACAGACACACAGTTTCTAGAGCTTATGGCATTTTTGCTA
GCAGTATTCACACTCATGGTAACTTTGGCCTTGGTGGTTCTCTCCTACACACTCATCCTT
AAAACAATTCTGAAGATTCCCTCTGCCCAGCAAAGGAAAAAGGCTTTTTCAACTTGTTCC
TCCCATATGATTGTGGTTTCTGTTTCTTATGGGAGTTGCATTTTTATGTGTGTAAAAACA
TCTGCAAAAGAAGGTATGGCTTTGAGCAAAGGTGTAGCAGTGCTTAATACCTCTGTTGCT
CCTATGTTGAATCCCTTTATTTATACCTTAAGAAACCAGCAGGTGAAACAGGCCCTTAGG
GAATTCACCAAAAAAATATTATCATTGAACAAGCAA
Conceptual translation MPNMTSIREFILLGFTDNPELQVVIFFFMLITYLLSVSGNMIIIMLTLSNIHLKTPMYFF
LRNFSFLEISFTTVFIPRFLINIATGDTTISYNASMAQVFFLILLGSTEFFLLAVMSYDR
YVAICKPLHYTTIMSNKVCNWLVISSWLAGFLIIFPPVIMGLQLDFCDSSTIDHFICDSS
PMLLIACTDTQFLELMAFLLAVFTLMVTLALVVLSYTLILKTILKIPSAQQRKKAFSTCS
SHMIVVSVSYGSCIFMCVKTSAKEGMALSKGVAVLNTSVAPMLNPFIYTLRNQQVKQALR
EFTKKILSLNKQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 100 -100 NS A/G T/A 1000GP (YRI)
12 100 -100 SYN A/G Q/Q 1000GP (YRI, YRI, YRI)
12 55,401,192 55,401,192 NS A/G T/A 1000GP (CEU, CHBJPT)
12 55,794,343 55,794,343 NS A/C I/L rs61741338 (DbSNP)
12 55,794,350 55,794,350 NS A/T Q/L rs12424958 (DbSNP)
12 55,794,976 55,794,976 NS A/G T/A rs7971073 (DbSNP)
12 55,795,231 55,795,231 SYN C/T L/L rs61744496 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 16 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T222A % Freq CORP
1 A 75.50 0.934
2 T 24.50 0.934

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6C65.aApr07-unspliced main_exon CDS chr12 55,400,529 55,401,464 +
3UTR chr12 55,401,464 55,401,467 +