Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6C68 Olfactory Receptor

Gene Symbol OR6C681 (View this gene in GeneCards)
Family 6
Subfamily C
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases HsOR12.5.21
External Ids HGNC: 31297   GeneBank: NM_001005519   
Build #39 labels
Chromosomal location 12:55,492,363-55,493,313 (+)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6C2 74.68% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Chimp CONTIG*********** 97% 312
Cow OR6C268 81% 311
Cow OR6C68 81% 312

Expression evidences

Source Accession
ESTs EB388040

Sequence information

Nucleotide sequence ATGCAGAAGTCAGTAATGAGAAAACACACAGCAATAACAACATTCATCCTTCTGGGACTG
ACAGAAGATCCTCAGCTGCAGGTTCTGCTTTTCATGTTTCTATTTATCACCTACATGTTG
AGTGTAACAGGGAAACTGACCATTATCGCCCTCACCATGTTGGATCCCCACCTGAAAACA
CCCATGTATTTTTTTCTCCAAAATTTATCTTTCTTAGAAATCTCATTTACAGCTACCTGT
GTTCCAAGATTCTTATACAGTATCTCAACTGGGAACAAAATAATAACGTATAATGCATGT
GTCATTCAGCTATTTTTTGCAGACCTCTTTGGGGTAACTGAATTTTTTCTTTTGGCTACC
ATGTCATATGATCGCTATGTGGCCATCTGCAAACCCTTGCATTATATGGCAATCATGAGC
AACAAAGTGTGCAAAACAATGGTTATTTGTTGTTGGATGGCAGCACTTATGATTATCCTC
CCACCACTTAGCTTAGGTTTTCATCTAGAATTCTGTGACTCTAATGTCATCAATCATTTT
GGCTGTGATGCATTGCCTATTCTGAAAATACCATGCTCAGACACATCATTAATTGAGCAG
ATGGTTGTAGCCTCTGCTGTATTAACCTTTATTATCACTCTTGTATGTGTAGTTCTGTCC
TACACATATATCATAAGAACAATTCTAAAATTCCCTTCTGTTCAACAAAAGAAAAAAGCC
TTTTCTACCTGTTCTTCACATATTACTGTGGTTTCCATCACTTATGGCAGCTGCATCTTC
ATCTATATCAAGCCATCTGCAAAAGAAGAGGTAAACATTAATAAAGGTGTGTCAGTGCTT
ATTTCATCCATATCACCTATGTTGAATTCTTTCATATATACTCTTAGGAATGAGCAAGTT
AAACAAGCCTTTCATGACTCACTCAAAAAAATTGCATTTCGTTTAAAAAAG
Conceptual translation MRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIALTMLDPHLKTPMYFF
LQNLSFLEISFTATCVPRFLYSISTGNKIITYNACVIQLFFADLFGVTEFFLLATMSYDR
YVAICKPLHYMAIMSNKVCKTMVICCWMAALMIILPPLSLGFHLEFCDSNVINHFGCDAL
PILKIPCSDTSLIEQMVVASAVLTFIITLVCVVLSYTYIIRTILKFPSVQQKKKAFSTCS
SHITVVSITYGSCIFIYIKPSAKEEVNINKGVSVLISSISPMLNSFIYTLRNEQVKQAFH
DSLKKIAFRLKK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 55,886,276 55,886,275 Ins(1) -/G rs36002641 (DbSNP)
12 55,886,294 55,886,294 NS A/G T/A rs7133698 (DbSNP)
12 55,886,489 55,886,489 NS A/T I/F rs7304753 (DbSNP)
12 55,887,054 55,887,054 NS C/G A/G rs56760228 (DbSNP)
12 55,886,652 55,886,652 NS C/T P/L rs61747528 (DbSNP)
12 55,887,087 55,887,087 NS G/T R/L rs12579181 (DbSNP)
12 55,492,705 55,492,705 NS T/A F/I 1000GP (CEU, CHBJPT)
12 55,493,303 55,493,303 NS G/T R/L 1000GP (CEU, CHBJPT)
12 55,492,412 55,492,412 NS T/C L/P 1000GP (CEU)
12 55,492,510 55,492,510 NS G/A A/T 1000GP (CEU, CHBJPT)
12 55,492,595 55,492,595 NS C/T A/V 1000GP (CHBJPT)
12 100 -100 NS G/A A/T 1000GP (YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
12 55,832,210 56,001,052 CopyNumber Variation_4780 (DGV)
CopyNumber 17 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L17P A50T A78V F115I C192R A303G A312P R314L % Freq CORP
1 L A A F C A A R 34.87 1.000
2 L T A F C A A R 27.19 1.000
3 L T A I C A A L 24.81 1.000
4 L T A F C G A L 5.61 1.000
5 L T A F C A A L 2.92 1.000
6 L A V F C A A L 2.15 1.000
7 L A A F C A A L 1.08 1.000
8 P T A F C A A R 0.61 1.000
9 L A A F R A A R 0.31 1.000
10 L A A F C A P L 0.23 1.000
11 L A A F C G A L 0.15 1.000
12 L T A I C A A R 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6C68.aApr07-unspliced main_exon 5UTR chr12 55,491,967 55,492,363 +
CDS chr12 55,492,363 55,493,313 +
3UTR chr12 55,493,313 55,493,316 +