Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6C70 Olfactory Receptor

Gene Symbol OR6C701 (View this gene in GeneCards)
Family 6
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.46 (functional)
Aliases HsOR12.5.20
External Ids HGNC: 31299   GeneBank: NM_001005499   
Build #39 labels
Chromosomal location 12:55,469,203-55,470,138 (-)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6C6 74.75% 305
OR6C75 69.87% 312
OR6C76 71.57% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Chimp CONTIG*********** 75% 305
Cow OR6C270P 81% 311
Cow OR6C272P 82% 312

Expression evidences

Source Accession
GNF Atlas2 gnf1h10941_at

Sequence information

Nucleotide sequence ATGAAGAATCATACAAGGCAGATAGAATTTATTCTTCTGGGACTGACGGATAATTCTCAG
TTACAGATTGTAATTTTCTTATTTCTACTTCTAAATTGTGTGTTGAGCATGATAGGGAAC
TTCACTATCATTGCCCTCATTCTGCTGGATTCCCAGCTCAAGACTCCAATGTATTTCTTC
CTCCGTAATTTCTCTTTTCTGGAAATTTCATTCACAACTGCTTGCATTCCCAGATTCCTA
ATCACCATTGTTACCAGGGAAAAGACCATTTCCTGTAATGGTTGCATATCTCAGTTGTTT
TTTTACATATTCTTGGGGGTTACAGAATTTTTCCTTCTAGCTGCTCTGTCCTATGATCGC
TATGTTGCCATCTGCAAACCTTTGCGTTATATGTCCATCATGAGTAACAAAGTTTGCTAC
CAGCTTGTATTCAGTTCTTGGGTAACTGGATTCCTGATCATTTTCACTCCACTGATTTTA
GGTCTTAACTTGGATTTCTGTGCTTCAAATATCATTGATCATTTCATTTGTGACATTTCT
CTTATCCTACAACTTTCTTGCTCAGACACACATTTACTGGAACTGATTGCCTTTTTATTA
GCTGTGATGACACTTATTGTCACATTGTTTTTAGTAATCCTTTCTTACTCTTACATCATC
AAGACAATTCTGAAATTCCCTTCAGCTCAGCAAAAGAAGAAAGCCTTTTCCACCTGCTCT
TCTCACATGATTGTTGTCTCCATCACTTATGGTAGTTGTATGTTTATCTACATAAAGCCA
TCAGCGAATGAAAGAGTTGCTTTAAGCAAAGGAGTAACTGTGCTCAATACTTCAGTTGCC
CCGTTGTTAAACCCATTTATTTATACTCTGAGGAATCAGCAAGTTAAACAAGCCTTCAAA
GCTGTATTTAGAAAGATATTTTCTGCTTCAGACAAG
Conceptual translation MKNHTRQIEFILLGLTDNSQLQIVIFLFLLLNCVLSMIGNFTIIALILLDSQLKTPMYFF
LRNFSFLEISFTTACIPRFLITIVTREKTISCNGCISQLFFYIFLGVTEFFLLAALSYDR
YVAICKPLRYMSIMSNKVCYQLVFSSWVTGFLIIFTPLILGLNLDFCASNIIDHFICDIS
LILQLSCSDTHLLELIAFLLAVMTLIVTLFLVILSYSYIIKTILKFPSAQQKKKAFSTCS
SHMIVVSITYGSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK
AVFRKIFSASDK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 55,863,453 55,863,453 NS A/G L/P rs56038718 (DbSNP)
12 55,863,381 55,863,381 NS A/G L/P rs10747756 (DbSNP)
12 55,862,990 55,862,990 NS C/G E/D rs7295538 (DbSNP)
12 55,863,224 55,863,224 NS C/G K/N rs60683621 (DbSNP)
12 55,863,537 55,863,537 NS C/T R/H rs58920821 (DbSNP)
12 55,863,398 55,863,398 SYN A/G F/F rs12313730 (DbSNP)
12 55,469,614 55,469,614 SYN G/A F/F 1000GP (CEU, CHBJPT)
12 55,469,440 55,469,440 NS C/G K/N 1000GP (CEU, CHBJPT)
12 55,469,597 55,469,597 NS A/G L/P 1000GP (CEU, CHBJPT)
12 55,469,398 55,469,398 SYN G/C S/S 1000GP (CHBJPT)
12 55,469,753 55,469,753 NS C/T R/H 1000GP (CHBJPT)
12 100 -100 NS G/C D/E 1000GP (YRI, YRI, YRI)
12 100 -100 SYN G/A L/L 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
12 55,863,381 55,864,826 CopyNumber Variation_1501 (DGV)
12 55,832,210 56,001,052 CopyNumber Variation_4780 (DGV)
CopyNumber 179 (Hasin)
12 55,860,987 55,864,022 CopyNumber #128 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

D311E K233N V212A L181P I171V Q141* C139S R129H R120H A114S T73A % Freq CORP
1 D K V P I Q C R R A T 53.15 0.671
2 D N V P I Q C R R A T 25.04 0.671
3 D K V L I Q C R R A T 15.44 0.671
4 D K V P I Q C H R A T 2.00 0.671
5 E K V P I Q C R R A T 1.54 0.671
6 D N V P I Q C R R S T 1.08 0.671
7 D K V P I Q C R R A A 1.00 0.671
8 D K V P I Q S R R A T 0.23 0.671
9 D K V P I * C R R A T 0.15 1.200
10 D K V P I Q C H H A T 0.08 0.973
11 D N V L I Q C R R A T 0.08 0.671
12 D N V P I Q C R H A T 0.08 0.973
13 D N V P V Q C R R A T 0.08 0.671
14 D K A P I Q C R R A T 0.08 0.671

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6C70.aApr07-unspliced main_exon 3UTR chr12 55,469,200 55,469,203 -
CDS chr12 55,469,203 55,470,138 -