Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6C75 Olfactory Receptor

Gene Symbol OR6C751 (View this gene in GeneCards)
Family 6
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.07 (functional)
Aliases HsOR12.5.14
External Ids HGNC: 31304   GeneBank: NM_001005497   
Build #39 labels
Chromosomal location 12:55,365,111-55,366,046 (+)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6C3 71.94% 310
OR6C66P 73.77% 305
OR6C74 72.99% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6C75 83% 312
Dog OR6C75D 83% 312
Dog OR6C75C 83% 312
Chimp CONTIG802.61-16852 70% 308
Chimp CONTIG*********** 73% 301
Chimp CONTIG*********** 71% 305
Mouse Or6c75 88% 309
Rat Or6c75-ps 85% 312
Cow OR6C75 87% 312

Sequence information

Nucleotide sequence ATGAGAAATTCCACAGCAGTAACAGACTTTATTCTTCTTGGATTGACAAGTGACCCACAG
TGGCAGGTTGTACTTTTCATATTTCTTCTTGTTACCTACATGTTAAGTGTGACTGGGAAC
CTGATCATTATCACCCTCACCCTTTCAGATCCCCATCTGCAGACTCCCATGTATTTCTTC
CTTCGGAACTTCTCATTCCTGGAAATTTCATTCACGTCTGTCTGCATTCCCAGATTCCTT
GTCACTGTTGTGACAGGAAACAGAACCATTTCTTATAATGGGTGTGTGGCTCAGCTATTT
TTTTTCATCTTCTTGGGGGTGACAGAATTTTACCTTCTGGCTGCCATGTCCTATGACCGC
TGCATGGCCATCTGCAAACCTCTTCATTACACAATCATCATGAGCACCAGAGTGTGTACC
CTTCTTGTCTTTAGCTCCTGGCTTGCAGGGTTTCTGATCATCTTTCCACCAGTAATGCTT
CTGCTGCAGTTGGATTTCTGTGCCTCCAATGTAATTGATCATTTTATCTGTGACTCTTCT
CCAATGCTGCAGCTCTCTTGCACAAACACTCACTTTCTAGAACTCATGGCATTTTTTTTA
GCTGTGGTAACACTGATGGTCACCTTGACATTAGTTATTCTCTCCTACACAAACATCATC
CGGACAATTCTGAAAATTCCTTCTATGAGTCAAAGGAAAAAAGCCTTTTCCACTTGCTCC
TCCCATATGATAGTTGTCTCCATCTCTTACAGTAGCTGTATCTTCATGTACATTAAGACT
TCTGCCAGAGAAAGGGTGACTTTAAGCAAAGGAGTAGCTGTGCTCAATACCTCAGTGGCT
CCTCTCTTGAATCCCTTCATATACACACTGAGAAATAAGCAAGTGAAGCAAGCCTTCAAG
AGCATGGTCCAGAAGATGATTTTTTCTTTAAATAAA
Conceptual translation MRNSTAVTDFILLGLTSDPQWQVVLFIFLLVTYMLSVTGNLIIITLTLSDPHLQTPMYFF
LRNFSFLEISFTSVCIPRFLVTVVTGNRTISYNGCVAQLFFFIFLGVTEFYLLAAMSYDR
CMAICKPLHYTIIMSTRVCTLLVFSSWLAGFLIIFPPVMLLLQLDFCASNVIDHFICDSS
PMLQLSCTNTHFLELMAFFLAVVTLMVTLTLVILSYTNIIRTILKIPSMSQRKKAFSTCS
SHMIVVSISYSSCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFK
SMVQKMIFSLNK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 55,759,000 55,759,000 NS A/C S/R rs72482251 (DbSNP)
12 55,759,315 55,759,315 NS C/T L/F rs7976023 (DbSNP)
12 55,759,598 55,759,598 NS A/C D/A rs7976416 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 108 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L141F I176V A235D C253S % Freq CORP
1 L I A C 98.80 0.087
2 F I D C 0.55 0.215
3 F I A C 0.33 0.087
4 L V A C 0.22 0.087
5 L I A S 0.11 0.087

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6C75.aApr07-unspliced main_exon CDS chr12 55,365,111 55,366,046 +
3UTR chr12 55,366,046 55,366,049 +