Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6C76 Olfactory Receptor

Gene Symbol OR6C761 (View this gene in GeneCards)
Family 6
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.65 (pseudogene)
Aliases HsOR12.5.18
External Ids HGNC: 31305   GeneBank: NM_001005183   
Build #39 labels
Chromosomal location 12:55,426,254-55,427,189 (+)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6C65 74.36% 312
OR6C66P 77.42% 310
OR6C74 73.53% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6C76P 84% 309
Chimp CONTIG*********** 74% 296
Chimp CONTIG*********** 71% 305
Chimp CONTIG*********** 70% 306
Mouse Or6c76 89% 305
Mouse Or6c76b 87% 305
Rat Or6c76b 88% 305
Rat Or6c76-ps 86% 305
Cow OR6C76 88% 309

Sequence information

Nucleotide sequence ATGAAAAATAGAACATCAGTGACAGATTTCATCCTTCTGGGTCTGACGGATAATCCGCAA
CTGCAGGTTGTGATTTTCTCGTTCCTATTTCTTACGTATGTACTGAGTGTTACTGGAAAT
CTAACTATCATCTCCCTTACCCTGCTGGATTCCCACCTGAAGACCCCCATGTATTTCTTC
CTCAGGAATTTCTCCTTGGAAATTTCATTTACTTCTGTCTGTAATCCTAGATTTCTGATC
AGCATTCTAACAGGGGACAAATCCATATCTTATAATGCTTGTGCAGCTCAGCTATTTTTC
TTTATCTTCCTTGGCTCAACGGAGTTTTTCCTCCTGGCCTCTATGTCCTATGATTGCTAT
GTGGCTATATGTAAGCCTCTGCATTATACAACCATCATGAGTGACAGGATCTGTTATCAG
CTTATAATCAGCTCTTGGCTGGCTGGTTTCTTGGTAATTTTTCCACCACTGGCCATGGGC
TTACAGCTGGATTTCTGTGACTCCAATGTCATTGACCACTTTACCTGTGACTCTGCTCCT
TTGCTGCAAATCTCTTGCACAGACACAAGTACTCTAGAGCTCATGAGCTTTATTTTAGCT
CTGTTTACTCTTATATCCACTTTGATATTAGTAATTCTCTCCTATACTTACATCATCAGA
ACTATTCTGAGAATCCCCTCAGCACAGCAAAGAAAAAAAGCCTTTTCAACCTGCTCCTCA
CATGTGATTGTTGTCTCTATCTCTTATGGAAGCTGCATCTTCATGTATGTGAAAACATCA
GCAAAGGAAGGAGTTGCTTTGACAAAAGGAGTAGCTATACTCAATACCTCTGTCGCTCCT
ATGCTGAATCCATTTATTTACACTCTAAGAAACCAGCAGGTGAAACAAGCATTTAAGGAT
GTTCTGAGAAAGATTTCCCACAAAAAAAAAAAACAC
Conceptual translation MKNRTSVTDFILLGLTDNPQLQVVIFSFLFLTYVLSVTGNLTIISLTLLDSHLKTPMYFF
LRNFSLEISFTSVCNPRFLISILTGDKSISYNACAAQLFFFIFLGSTEFFLLASMSYDCY
VAICKPLHYTTIMSDRICYQLIISSWLAGFLVIFPPLAMGLQLDFCDSNVIDHFTCDSAP
LLQISCTDTSTLELMSFILALFTLISTLILVILSYTYIIRTILRIPSAQQRKKAFSTCSS
HVIVVSISYGSCIFMYVKTSAKEGVALTKGVAILNTSVAPMLNPFIYTLRNQQVKQAFKD
VLRKISHKKKKH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 100 -100 NS G/A V/I 1000GP (YRI, YRI, YRI, YRI)
12 100 -100 SYN G/A T/T 1000GP (YRI, YRI, YRI, YRI, YRI)
12 55,426,337 55,426,337 SYN C/T F/F 1000GP (CEU, CHBJPT)
12 55,426,418 55,426,418 SYN C/T T/T 1000GP (CEU)
12 55,820,104 55,820,104 NS A/G I/V rs74092309 (DbSNP)
12 55,820,121 55,820,121 SYN C/T F/F rs6581046 (DbSNP)
12 55,820,194 55,820,194 SYN C/T L/L rs74092310 (DbSNP)
12 55,820,358 55,820,358 SYN A/G T/T rs12322458 (DbSNP)
12 55,820,904 55,820,903 Ins(1) -/T rs58396798 (DbSNP)
12 55,820,927 55,820,927 NS C/T A/V rs73327795 (DbSNP)
12 55,820,959 55,820,959 Del(1) -/A rs67035246 (DbSNP)
12 55,820,970 55,820,970 Del(1) -/A rs57387180 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
12 55,819,938 55,822,973 Deletion #236 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V23I I80M T107M A158T R224G A297V % Freq CORP
1 V I T A R A 89.93 0.729
2 V I T A R V 3.28 0.729
3 V I M A R A 2.19 0.729
4 I I T A R A 1.97 0.729
5 V I T T R A 1.42 0.729
6 V I T A G A 0.88 0.729
7 V M T A R A 0.33 0.729

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6C76.aApr07-unspliced main_exon CDS chr12 55,426,254 55,427,189 +
3UTR chr12 55,427,189 55,427,192 +