Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6J1 Olfactory Receptor

Gene Symbol OR6J11 (View this gene in GeneCards)
Family 6
Subfamily J
Pseudogene No
CORP pseudogene probability score
Aliases HsOR14.3.1
External Ids HGNC: 14707   GeneBank: AB065892   
Build #39 labels OR6J2, OR6J1P
Chromosomal location 14:22,633,771-22,634,811 (-)
Cluster 14@23
Synteny CLIC#36
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs3751484)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6M1 54.78% 314
OR6M2P 52.44% 307
OR6R1P 52.49% 301

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6M6 58% 302
Chimp CONTIG55725.1-561 97% 347
Chimp CONTIG*********** 98% 249
Mouse Or6s1 51% 307
Rat Or6s1 51% 316
Cow OR6J1P 83% 292

Expression evidences

Source Accession
ESTs BF363816
GNF Atlas2 gnf1h02814_at

Sequence information

Nucleotide sequence ATGGGTAACTGGACTGCAGCGGTGACTGAGTTTGTTCTGCTGGGGTTTTCCCTGAGCAGG
GAGGTGGAGCTGCTGCTCCTGGTGCTCCTGCTGCCCACGTTCCTGCTGACTCTTCTGGGG
AACCTGCTCATCATCTCCACTGTGCTGTCCTGCTCCCGCCTCCACACCCCCATGTACTTC
TTCTTGTGCAACCTCTCTATCCTGGACATCCTCTTCACCTCAGTCATCTCTCCAAAAGTG
TTGGCCAACTTAGGATCTAGGGATAAAACCATCTCCTTTGCCGGATGTATCACCCAGTGC
TATTTCTACTTTTTCTTGGGCACAGTTGAGTTCCTCCTGCTGACGGTCATGTCCTATGAC
CGTTATGCCACCATCTGCTGCCCCCTGCGGTACACCACCATCATGAGACCTTCTGTCTGC
ATTGGGACCGTTGTATTCTCTTGGGTGGGAGGCTTCCTGTCTGTGCTCTTTCCAACCATC
CTCATCTCCCAGCTGCCCTTCTGTGGCTCCAATATCATTAACCACTTCTTCTGTGACAGT
GGACCCTTGCTGGCCCTGGCCTGTGCAGACACCACTGCCATCGAGCTGATGGATTTTATG
CTTTCTTCCATGGTCATCCTCTGCTGCATAGTCCTCGTGGCCTATTCCTATACGTACATC
ATCTTGACCATAGTGCGCATTCCTTCTGCAAGTGGAAGGAAGAAGGCCTTTAATACCTGT
GCTTCCCACCTGACCATAGTCATCATTCCTAGTGGCATCACTGTGTTTATCTATGTGACT
CCCTCCCAGAAAGAATATCTGGAGATCAACAAGATCCCTTTGGTTCTGAGCAGTGTGGTG
ACTCCATTCCTCAACCCCTTTATATATACTCTGAGGAATGACACAGTGCAGGGAGTCCTC
AGGGATGTGTGGGTCAGGGTTCGAGGAGTTTTTGAAAAGAGGATGAGGGCAGTGCTGAGA
AGCAGATTATCCTCCAACAAAGACCACCAAGGAAGGGCTTGCTCTTCTCCACCATGTGTC
TATTCTGTAAAGCTCCAGTGT
Conceptual translation MGNWTAAVTEFVLLGFSLSREVELLLLVLLLPTFLLTLLGNLLIISTVLSCSRLHTPMYF
FLCNLSILDILFTSVISPKVLANLGSRDKTISFAGCITQCYFYFFLGTVEFLLLTVMSYD
RYATICCPLRYTTIMRPSVCIGTVVFSWVGGFLSVLFPTILISQLPFCGSNIINHFFCDS
GPLLALACADTTAIELMDFMLSSMVILCCIVLVAYSYTYIILTIVRIPSASGRKKAFNTC
ASHLTIVIIPSGITVFIYVTPSQKEYLEINKIPLVLSSVVTPFLNPFIYTLRNDTVQGVL
RDVWVRVRGVFEKRMRAVLRSRLSSNKDHQGRACSSPPCVYSVKLQC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 NS G/A S/F 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
14 100 -100 SYN A/G F/F 1000GP (YRI, YRI, YRI, YRI)
14 22,633,879 22,633,879 SYN A/G F/F 1000GP (CEU, CHBJPT)
14 22,633,977 22,633,977 NS C/A V/L 1000GP (CEU, CHBJPT)
14 22,633,991 22,633,991 NS A/G L/S 1000GP (CEU, CHBJPT)
14 22,634,064 22,634,064 NS G/A P/S 1000GP (CEU, CHBJPT)
14 22,634,135 22,634,135 NS C/T R/H 1000GP (CEU, CHBJPT)
14 22,634,139 22,634,139 NS C/T V/M 1000GP (CEU)
14 22,634,318 22,634,318 NS A/G L/P 1000GP (CEU)
14 22,634,377 22,634,377 SYN T/C V/V 1000GP (CEU, CHBJPT)
14 22,634,399 22,634,399 NS G/T S/Y 1000GP (CEU)
14 22,634,442 22,634,442 NS T/C T/A 1000GP (CEU, CHBJPT)
14 22,634,449 22,634,449 SYN A/G R/R 1000GP (CEU, CHBJPT)
14 22,634,450 22,634,450 NS C/T R/H 1000GP (CEU, CHBJPT)
14 22,634,451 22,634,451 NS G/A R/C 1000GP (CEU)
14 22,634,639 22,634,639 NS A/G M/T 1000GP (CEU)
14 23,102,784 23,102,784 SYN A/G F/F rs1753429 (DbSNP)
14 23,102,882 23,102,882 NS A/C L/V rs1681596 (DbSNP)
14 23,102,896 23,102,896 NS A/G L/S rs1681597 (DbSNP)
14 23,102,969 23,102,969 NS A/G S/P rs1753430 (DbSNP)
14 23,103,040 23,103,040 NS C/T R/H rs3829405 (DbSNP)
14 23,103,044 23,103,044 NS C/T V/M rs1681598 (DbSNP)
14 23,103,282 23,103,282 SYN C/T V/V rs3751481 (DbSNP)
14 23,103,304 23,103,304 NS G/T S/Y rs45470397 (DbSNP)
14 23,103,347 23,103,347 NS C/T A/T rs3751482 (DbSNP)
14 23,103,354 23,103,354 SYN A/G R/R rs3751483 (DbSNP)
14 23,103,355 23,103,355 NS C/T R/H rs3751484 (DbSNP)
14 23,103,356 23,103,356 NS A/G C/R rs45494902 (DbSNP)
14 23,103,373 23,103,373 NS G/T T/K rs45479894 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
14 23,090,983 23,111,555 CopyNumber Variation_35239 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S335F R314W V279L L274S P250S R226H V225M T218M G169R L165P S138Y R130W T124A R121H R121C T115K M58T R53H S17P A7V % Freq CORP
1 S R V L P R V T G L S R T R R T M R S A 42.47 1.000
2 S R V L S R V T G L S R T R R T M R S A 31.57 1.000
3 S R L S S H V T G L S R A H R T M R S A 14.44 0.088
4 S R V L S R V T G L S R T R R T T R S A 2.15 1.000
5 S R L S S H V T G L S R T R R T M R S A 2.07 1.000
6 S R L S S R M T G L Y R A R C T M R S A 1.92 0.632
7 S R L S S H V T G L S R A H R T M R P A 1.08 0.088
8 S R L S S H V T G L S R A R R T M R S A 0.84 0.088
9 S R V L P R V T G L S R T R R K M R S A 0.69 1.000
10 S R L S S H V T G P S R A H R T M R S A 0.38 0.088
11 S R V L S R V T G L S R T R R T M H S A 0.23 1.000
12 S R L S S R M T G L Y R A H R T M R S A 0.23 0.088
13 S R V L P R V T G L S R T R R T M R S V 0.23 1.000
14 S R V L S H V T G L S R A H R T M R S A 0.15 0.088
15 F R V L P R V T G L S R T R R T M R S A 0.15 1.000
16 S R V L S H V T G L S R T R R T M R S A 0.15 1.000
17 S R L S S H V T G P S R A R R T M R S A 0.15 0.088
18 S R L S S H V T G P S R T R R T M R S A 0.15 1.000
19 S R V L S H V T G P S R A H R T M R S A 0.08 0.088
20 S R V L S R V M G L S R T R R T M R S A 0.08 1.000
21 S R L S S R M T G L S R T R R T M R S A 0.08 1.000
22 S W V L S R V T G L S R T R R T M R S A 0.08 1.000
23 S R V S S H V T G P S R A H R T M R S A 0.08 0.088
24 S R L S S R V T G L S R A H R T M R S A 0.08 0.088
25 S R V L P R V T R L S R T R R T M R S A 0.08 1.000
26 S R L L S H V T G L S R A H R T M R S A 0.08 0.088
27 S R V L P R V T G L S R T R R T M H S A 0.08 1.000
28 S R L S S H V T G L S R A R R T M R P A 0.08 0.088
29 S R V L P H V T G L S R T R R T M R S A 0.08 1.000
30 S R V L S R V T G L S W T R R T M R S A 0.08 1.000