Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6K6 Olfactory Receptor

Gene Symbol OR6K61 (View this gene in GeneCards)
Family 6
Subfamily K
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR1-21, HsOR1.4.16, ORL3010
External Ids HGNC: 15033   GeneBank: AB065650, BK004198, NM_001005184   ORDB: ORL3010   
Build #39 labels OR6K6
Chromosomal location 1:158,754,921-158,755,844 (+)
Cluster 1@159a
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6K4P 70.55% 292

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6K6 85% 304
Chimp CONTIG*********** 97% 308
Mouse Or6k6 83% 319
Rat Or6k6 82% 319
Cow OR6K6 85% 313

Expression evidences

Source Accession
mRNA BC140743
GNF Atlas2 gnf1h10921_at

Sequence information

Nucleotide sequence ATGGTGACTGAGTTCCTCTTCTCTATGTTCCCGCATGCGCACAGAGGTGGCCTCTTATTC
TTTATTCCCTTGCTTCTCATCTACGGATTTATCCTAACTGGAAACCTAATAATGTTCATT
GTCATCCAGGTGGGCATGGCCCTGCACACCCCTTTGTATTTCTTTATCAGTGTCCTCTCC
TTCCTGGAGATCTGCTATACCACAACCACCATCCCCAAGATGCTGTCCTGCCTAATCAGT
GAGCAGAAGAGCATTTCCGTGGCTGGCTGCCTCCTGCAGATGTACTTTTTCCACTCACTT
GGTATCACAGAAAGCTGTGTCCTGACAGCAATGGCCATTGACAGGTACATAGCTATCTGC
AATCCACTCCGTTACCCAACCATCATGATTCCCAAACTTTGTATCCAGCTGACAGTTGGA
TCCTGCTTTTGTGGCTTCCTCCTTGTGCTTCCTGAGATTGCATGGATTTCCACCTTGCCT
TTCTGTGGCTCCAACCAGATCCACCAGATATTCTGTGATTTCACACCTGTGCTGAGCTTG
GCCTGCACAGATACATTCCTAGTGGTCATTGTGGATGCCATCCATGCAGCGGAAATTGTA
GCCTCCTTCCTGGTCATTGCTCTATCCTACATCCGGATTATTATAGTGATTCTGGGAATG
CACTCAGCTGAAGGTCATCACAAGGCCTTTTCCACCTGTGCTGCTCACCTTGCTGTGTTC
TTGCTATTTTTTGGCAGTGTGGCTGTCATGTATTTGAGATTCTCAGCCACCTACTCAGTG
TTTTGGGACACAGCAATTGCTGTCACTTTTGTTATCCTTGCTCCCTTTTTCAACCCCATC
ATCTATAGCCTGAAAAACAAGGACATGAAAGAGGCTATTGGAAGGCTTTTCCACTATCAG
AAGAGGGCTGGTTGGGCTGGGAAA
Conceptual translation MTQLTASGNQTMVTEFLFSMFPHAHRGGLLFFIPLLLIYGFILTGNLIMFIVIQVGMALH
TPLYFFISVLSFLEICYTTTTIPKMLSCLISEQKSISVAGCLLQMYFFHSLGITESCVLT
AMAIDRYIAICNPLRYPTIMIPKLCIQLTVGSCFCGFLLVLPEIAWISTLPFCGSNQIHQ
IFCDFTPVLSLACTDTFLVVIVDAIHAAEIVASFLVIALSYIRIIIVILGMHSAEGHHKA
FSTCAAHLAVFLLFFGSVAVMYLRFSATYSVFWDTAIAVTFVILAPFFNPIIYSLKNKDM
KEAIGRLFHYQKRAGWAGK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS G/C E/D 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN T/C I/I 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
1 158,724,722 158,724,722 NS C/G D/E rs16840974 (DbSNP)
1 158,724,750 158,724,750 NS C/T H/Y rs16840976 (DbSNP)
1 158,724,794 158,724,794 SYN C/T Y/Y rs57046052 (DbSNP)
1 158,724,844 158,724,844 NS A/G D/G rs16840980 (DbSNP)
1 158,724,965 158,724,965 SYN C/T I/I rs16840986 (DbSNP)
1 158,724,988 158,724,988 NS A/G Q/R rs74122455 (DbSNP)
1 158,725,006 158,725,006 NS C/T S/L rs16840991 (DbSNP)
1 158,725,080 158,725,080 NS C/T R/C rs16841001 (DbSNP)
1 158,725,100 158,725,100 SYN C/T I/I rs7540544 (DbSNP)
1 158,725,194 158,725,194 NS C/T R/C rs16841009 (DbSNP)
1 158,725,237 158,725,237 NS C/T P/L rs16841017 (DbSNP)
1 158,725,269 158,725,269 SYN C/T L/L rs74122456 (DbSNP)
1 158,725,301 158,725,301 SYN A/G A/A rs16841025 (DbSNP)
1 158,725,310 158,725,310 SYN A/T V/V rs16841033 (DbSNP)
1 158,725,345 158,725,345 NS A/G Q/R rs16841038 (DbSNP)
1 158,725,387 158,725,387 NS A/G H/R rs16841042 (DbSNP)
1 158,725,564 158,725,564 NS A/G K/R rs16841045 (DbSNP)
1 158,755,021 158,755,021 NS G/A G/E 1000GP (CEU)
1 158,755,290 158,755,290 NS C/T R/C 1000GP (CEU, CHBJPT)
1 158,755,359 158,755,359 NS C/T L/F 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
1 158,725,318 158,726,269 InDel Variation_97523 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

E15D H25Y G45E G56D Q104R S110L R135C C173R P187L R223Q I224N H237R A276V K296R % Freq CORP
1 E H G G Q S R C P R I H A K 80.95 0.558
2 E H G G Q S C C P R I H A K 10.91 0.558
3 E Y G D R L R R L Q I R A R 3.76 0.914
4 D Y G D R L R R L Q I H A R 3.46 0.898
5 E H E G Q S C C P R I H A K 0.31 0.558
6 E Y G D R L R C P R I H A K 0.08 0.898
7 D Y G D R L R R L Q I R A R 0.08 0.914
8 E Y G D R L R R L Q I H A R 0.08 0.898
9 D Y G D Q S R C P R I H A K 0.08 0.558
10 D Y G G Q S R C P R I H A K 0.08 0.558
11 E H G G Q S R C P R N H A K 0.08 0.558
12 D H G D Q S R R P R I H A K 0.08 0.558
13 E H G G Q S R C P R I H V K 0.08 0.558

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6K6.aApr07-unspliced main_exon 5UTR chr1 158,754,816 158,754,921 +
CDS chr1 158,754,921 158,755,844 +
3UTR chr1 158,755,844 158,755,847 +