Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6P1 Olfactory Receptor

Gene Symbol OR6P11 (View this gene in GeneCards)
Family 6
Subfamily P
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR1-12, HsOR1.4.8, ORL3014
External Ids HGNC: 15036   GeneBank: AB065637, AF399473, BK004193, NG_004287   ORDB: ORL3014   
Build #39 labels OR6P1
Chromosomal location 1:158,562,654-158,563,604 (-)
Cluster 1@159a
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6A2 58.72% 298
OR6B1 57.63% 295
OR6Y1 59.6% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6P1 90% 317
Chimp CONTIG705.25-11276 99% 317
Mouse Or6p1 90% 317
Rat Or6p1 88% 317
Cow OR6P1 86% 317

Expression evidences

Source Accession
GNF Atlas2 gnf1h01973_at
GNF Atlas2 gnf1h01974_s_at

Sequence information

Nucleotide sequence ATGAGAAATTTGAGTGGAGGCCATGTCGAGGAGTTTGTCTTGGTGGGTTTCCCTACCACG
CCTCCCCTCCAGCTGCTCCTCTTTGTCCTTTTTTTTGCAATTTACCTTCTGACATTGTTG
GAGAATGCACTTATTGTCTTCACAATATGGCTTGCTCCAAGCCTTCATCGTCCCATGTAC
TTTTTCCTTGGCCATCTCTCTTTCCTGGAGCTATGGTACATCAATGTCACCATTCCTCGG
CTCTTGGCAGCCTTTCTTACCCAGGATGGTAGAGTCTCCTACGTAGGTTGCATGACCCAA
CTGTACTTCTTTATTGCCTTAGCCTGTACTGAATGTGTGCTGTTGGCAGTTATGGCCTAT
GATCGCTACCTGGCCATCTGTGGACCCCTCCTTTACCCTAGTCTCATGCCTTCCAGTCTG
GCCACTCGCCTTGCTGCTGCCTCTTGGGGCAGTGGCTTCTTCAGCTCCATGATGAAGCTT
CTTTTTATTTCCCAATTGTCCTACTGTGGACCCAACATTATCAACCACTTTTTCTGTGAT
ATTTCCCCACTACTCAACCTCACCTGCTCTGACAAGGAGCAAGCAGAGCTAGTAGACTTC
CTTCTGGCCCTGGTGATGATTCTACTCCCTCTATTGGCTGTGGTTTCATCATACACTGCC
ATCATTGCAGCCATCCTGAGGATCCCTACGTCCAGGGGACGCCACAAAGCCTTTTCCACT
TGTGCCGCTCATCTGGCAGTGGTTGTTATCTACTACTCCTCCACTCTCTTCACCTATGCA
CGGCCCCGGGCCATGTACACCTTCAACCACAACAAGATTATCTCTGTGCTCTACACTATC
ATTGTACCATTCTTCAACCCAGCCATCTACTGCCTGAGGAACAAGGAGGTGAAGGAGGCC
TTCAGGAAGACAGTGATGGGCAGATGTCACTATCCTAGGGATGTTCAGGAC
Conceptual translation MRNLSGGHVEEFVLVGFPTTPPLQLLLFVLFFAIYLLTLLENALIVFTIWLAPSLHRPMY
FFLGHLSFLELWYINVTIPRLLAAFLTQDGRVSYVGCMTQLYFFIALACTECVLLAVMAY
DRYLAICGPLLYPSLMPSSLATRLAAASWGSGFFSSMMKLLFISQLSYCGPNIINHFFCD
ISPLLNLTCSDKEQAELVDFLLALVMILLPLLAVVSSYTAIIAAILRIPTSRGRHKAFST
CAAHLAVVVIYYSSTLFTYARPRAMYTFNHNKIISVLYTIIVPFFNPAIYCLRNKEVKEA
FRKTVMGRCHYPRDVQD

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS C/A A/S 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN G/A I/I 1000GP (YRI, YRI, YRI, YRI)
1 158,532,460 158,532,460 NS A/G L/P rs41273495 (DbSNP)
1 158,532,607 158,532,607 NS C/T R/Q rs41273497 (DbSNP)
1 158,532,614 158,532,614 NS A/G W/R rs41273499 (DbSNP)
1 158,533,006 158,533,005 Ins(1) -/G rs34323808 (DbSNP)
1 158,533,017 158,533,017 SYN A/G I/I rs10489837 (DbSNP)
1 158,533,095 158,533,095 SYN C/T Q/Q rs73014246 (DbSNP)
1 158,533,140 158,533,140 SYN A/G F/F rs12080815 (DbSNP)
1 158,533,171 158,533,171 NS C/T S/N rs41273501 (DbSNP)
1 158,533,224 158,533,224 SYN A/G R/R rs12081915 (DbSNP)
1 158,562,657 158,562,657 NS C/A Q/H 1000GP (CEU)
1 158,562,670 158,562,670 NS G/A P/L 1000GP (CEU)
1 158,562,824 158,562,824 NS G/A R/W 1000GP (CEU)
1 158,563,350 158,563,350 SYN A/G F/F 1000GP (CEU, CHBJPT)
1 158,563,381 158,563,381 NS T/C N/S 1000GP (CEU)
1 158,563,434 158,563,434 SYN A/G R/R 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
1 158,530,444 158,533,494 Deletion #178 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R313K P312L A264S R261W R234H A223V L185F I163V M157K N75S M59R % Freq CORP
1 R P A R R A L I M N M 92.24 0.179
2 R P A W R A L I M N M 3.46 0.179
3 R P A R H A L I M N M 1.61 0.153
4 R P S R R A L V M N R 0.69 0.646
5 R P A R R V L I M N M 0.54 0.179
6 R L A R R A L I M N M 0.46 0.179
7 R P A R R A F I M N M 0.46 0.179
8 R P S R R A L V K N R 0.31 0.646
9 K P A R R A L I M N M 0.15 0.179
10 R P A R R A L I M S M 0.08 0.179