Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6S1 Olfactory Receptor

Gene Symbol OR6S11 (View this gene in GeneCards)
Family 6
Subfamily S
Pseudogene No
CORP pseudogene probability score 0.07 (functional)
Aliases OR14-37, HsOR14.1.30, ORL3694
External Ids HGNC: 15363   GeneBank: AB065561, BK004263, NM_001001968   ORDB: ORL3694   
Build #39 labels OR6S1
Chromosomal location 14:20,640,699-20,641,691 (-)
Cluster 14@21
Synteny CLIC#33
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6J1 51.47% 307
OR6M1 51.97% 304
OR6M2P 50.97% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6M2 53% 310
Mouse Or6s1 84% 328
Rat Or6s1 83% 331
Cow OR6M2 54% 310
Orang OR6S1P 96% 316
Horse OR6M2 54% 310
Chimp OR6M1 52% 309

Expression evidences

Source Accession
GNF Atlas2 gnf1h02811_at

Sequence information

Nucleotide sequence ATGAGTCCTGATGGGAACCACAGTAGTGATCCAACAGAGTTCGTCCTGGCAGGGCTCCCA
AATCTCAACAGCGCAAGAGTGGAATTATTTTCTGTGTTTCTTCTTGTCTATCTCCTGAAT
CTGACAGGCAATGTGTTGATTGTGGGGGTGGTAAGGGCTGATACTCGACTACAGACCCCT
ATGTACTTCTTTCTGGGTAACCTGTCCTGCCTAGAGATACTGCTCACTTCTGTCATCATT
CCAAAGATGCTGAGCAATTTCCTCTCAAGGCAACACACTATTTCCTTTGCTGCATGTATC
ACCCAATTCTATTTCTACTTCTTTCTCGGGGCCTCCGAGTTCTTACTGTTGGCTGTCATG
TCTGCGGATCGCTACCTGGCCATCTGTCATCCTCTGCGCTACCCCTTGCTCATGAGTGGG
GCTGTGTGCTTTCGTGTGGCCTTGGCCTGCTGGGTGGGGGGACTCGTCCCTGTGCTTGGT
CCCACAGTGGCTGTGGCCTTGCTTCCTTTCTGTAAGCAGGGTGCTGTGGTACAGCACTTC
TTCTGCGACAGTGGCCCACTGCTCCGCCTGGCTTGCACCAACACCAAGAAGCTGGAGGAG
ACTGACTTTGTCCTGGCCTCCCTCGTCATTGTATCTTCCTTGCTGATCACTGCTGTGTCC
TACGGCCTCATTGTGCTGGCAGTCCTGAGCATCCCCTCTGCTTCAGGCCGTCAGAAGGCC
TTCTCTACCTGTACCTCCCACTTGATAGTGGTGACCCTCTTCTATGGAAGTGCCATTTTT
CTCTATGTGCGGCCATCGCAGAGTGGTTCTGTGGACACTAACTGGGCAGTGACAGTAATA
ACGACATTTGTGACACCACTGTTGAATCCATTCATCTATGCCTTACGTAATGAGCAAGTC
AAGGAAGCTTTGAAGGACATGTTTAGGAAGGTAGTGGCAGGCGTTTTAGGGAATCTTTTA
CTTGATAAATGTCTCAGTGAGAAAGCAGTAAAG
Conceptual translation MSPDGNHSSDPTEFVLAGLPNLNSARVELFSVFLLVYLLNLTGNVLIVGVVRADTRLQTP
MYFFLGNLSCLEILLTSVIIPKMLSNFLSRQHTISFAACITQFYFYFFLGASEFLLLAVM
SADRYLAICHPLRYPLLMSGAVCFRVALACWVGGLVPVLGPTVAVALLPFCKQGAVVQHF
FCDSGPLLRLACTNTKKLEETDFVLASLVIVSSLLITAVSYGLIVLAVLSIPSASGRQKA
FSTCTSHLIVVTLFYGSAIFLYVRPSQSGSVDTNWAVTVITTFVTPLLNPFIYALRNEQV
KEALKDMFRKVVAGVLGNLLLDKCLSEKAVK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 NS G/T L/I 1000GP (YRI, YRI, YRI, YRI, YRI)
14 100 -100 SYN G/A G/G 1000GP (YRI, YRI, YRI, YRI, YRI)
14 20,640,750 20,640,750 SYN G/A G/G 1000GP (CEU, CHBJPT)
14 20,640,982 20,640,982 NS C/T R/H 1000GP (CEU, CHBJPT)
14 20,641,119 20,641,119 SYN A/T A/A 1000GP (CEU, CHBJPT)
14 20,641,226 20,641,226 NS C/T V/I 1000GP (CEU, CHBJPT)
14 20,641,512 20,641,512 SYN A/G P/P 1000GP (CEU, CHBJPT)
14 20,641,567 20,641,567 NS G/A T/I 1000GP (CEU, CHBJPT)
14 20,641,586 20,641,586 NS C/G V/L 1000GP (CEU)
14 21,108,909 21,108,909 SYN A/G G/G rs17277515 (DbSNP)
14 21,108,965 21,108,965 NS A/G C/R rs17114309 (DbSNP)
14 21,109,141 21,109,141 NS C/T R/H rs17277522 (DbSNP)
14 21,109,170 21,109,170 SYN A/T A/A rs11628297 (DbSNP)
14 21,109,255 21,109,255 NS C/T G/E rs45592635 (DbSNP)
14 21,109,278 21,109,278 SYN A/T A/A rs11627438 (DbSNP)
14 21,109,317 21,109,317 SYN T/C Q/Q rs61743445 (DbSNP)
14 21,109,385 21,109,385 NS C/T V/I rs11622969 (DbSNP)
14 21,109,505 21,109,505 NS G/T L/M rs72659934 (DbSNP)
14 21,109,671 21,109,671 SYN A/G P/P rs11627574 (DbSNP)
14 21,109,684 21,109,684 NS T/C Q/R rs61742423 (DbSNP)
14 21,109,726 21,109,726 NS A/G I/T rs11622794 (DbSNP)
14 21,109,745 21,109,745 NS C/G V/L rs45443395 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
14 20,800,765 21,257,878 CopyNumber Variation_71865 (DGV)
14 21,106,858 21,109,950 Deletion #238 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L319I R296C I280V R237H E199G R189H V176M V156I Y125H L116M L115S T42I V36L % Freq CORP
1 L R I R E R V I Y L L I V 44.24 0.116
2 L R I H E R V V Y L L T V 44.01 0.098
3 L C I H E R V V Y L L T V 3.00 0.098
4 L R I H E R V V Y L L T L 2.46 0.098
5 L R I R E R V V Y L L T V 1.69 0.116
6 L R I H E R V V Y L L I V 1.31 0.098
7 L R I H G R V V Y L L T V 0.77 0.098
8 L R I H E R V V Y M L T V 0.54 0.228
9 L R V R E R V I Y L L I V 0.54 0.116
10 L R I H E R V V H L L T V 0.31 0.066
11 L R I R E R V V Y L L I V 0.31 0.116
12 L R I R E R V I Y L L T V 0.23 0.116
13 I R I R E R V I Y L L I V 0.23 0.116
14 L R I H E R V V Y L S T V 0.15 0.098
15 L R I H E R M V Y L L T V 0.08 0.098
16 L C I H E R V V Y L L T L 0.08 0.098
17 L R I H E H V V Y L L T V 0.08 0.098

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6S1.aApr07-unspliced main_exon 3UTR chr14 20,640,696 20,640,699 -
CDS chr14 20,640,699 20,641,691 -