Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6V1 Olfactory Receptor

Gene Symbol OR6V11 (View this gene in GeneCards)
Family 6
Subfamily V
Pseudogene No
CORP pseudogene probability score 0.07 (functional)
Aliases OR7-3, HsOR7.6.2, ORL3172
External Ids HGNC: 15090   GeneBank: AB065697, AB065873, BK004392, NM_001001667   ORDB: ORL3172   
Build #39 labels OR6V1
Chromosomal location 7:143,052,341-143,053,279 (+)
Cluster 7@143a
Synteny CLIC#15
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6W1P 52.88% 295

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6V1 87% 312
Chimp CONTIG646.39-91 98% 186
Mouse Or6s1 47% 300
Rat Or6e1 47% 304
Cow OR6V1P 84% 312

Expression evidences

Source Accession
mRNA BC137044
GNF Atlas2 gnf1h10925_at

Sequence information

Nucleotide sequence ATGGCAAATCTGAGCCAGCCCTCCGAATTTGTCCTCTTGGGCTTCTCCTCCTTTGGTGAG
CTGCAGGCCCTTCTGTATGGCCCCTTCCTCATGCTTTATCTTCTCGCCTTCATGGGAAAC
ACCATCATCATAGTTATGGTCATAGCTGACACCCACCTACATACACCCATGTACTTCTTC
CTGGGCAATTTTTCCCTGCTGGAGATCTTGGTAACCATGACTGCAGTGCCCAGGATGCTC
TCAGACCTGTTGGTCCCCCACAAAGTCATTACCTTCACTGGCTGCATGGTCCAGTTCTAC
TTCCACTTTTCCCTGGGGTCCACCTCCTTCCTCATCCTGACAGACATGGCCCTTGATCGC
TTTGTGGCCATCTGCCACCCACTGCGCTATGGCACTCTGATGAGCCGGGCTATGTGTGTC
CAGCTGGCTGGGGCTGCCTGGGCAGCTCCTTTCCTAGCCATGGTACCCACTGTCCTCTCC
CGAGCTCATCTTGATTACTGCCATGGCGACGTCATCAACCACTTCTTCTGTGACAATGAA
CCTCTCCTGCAGTTGTCATGCTCTGACACTCGCCTGTTGGAATTCTGGGACTTTCTGATG
GCCTTGACCTTTGTCCTCAGCTCCTTCCTGGTGACCCTCATCTCCTATGGCTACATAGTG
ACCACTGTGCTGCGGATCCCCTCTGCCAGCAGCTGCCAGAAGGCTTTCTCCACTTGCGGG
TCTCACCTCACACTGGTCTTCATCGGCTACAGTAGTACCATCTTTCTGTATGTCAGGCCT
GGCAAAGCTCACTCTGTGCAAGTCAGGAAGGTCGTGGCCTTGGTGACTTCAGTTCTCACC
CCCTTTCTCAATCCCTTTATCCTTACCTTCTGCAATCAGACAGTTAAAACAGTGCTACAG
GGGCAGATGCAGAGGCTGAAAGGCCTTTGCAAGGCACAA
Conceptual translation MANLSQPSEFVLLGFSSFGELQALLYGPFLMLYLLAFMGNTIIIVMVIADTHLHTPMYFF
LGNFSLLEILVTMTAVPRMLSDLLVPHKVITFTGCMVQFYFHFSLGSTSFLILTDMALDR
FVAICHPLRYGTLMSRAMCVQLAGAAWAAPFLAMVPTVLSRAHLDYCHGDVINHFFCDNE
PLLQLSCSDTRLLEFWDFLMALTFVLSSFLVTLISYGYIVTTVLRIPSASSCQKAFSTCG
SHLTLVFIGYSSTIFLYVRPGKAHSVQVRKVVALVTSVLTPFLNPFILTFCNQTVKTVLQ
GQMQRLKGLCKAQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 100 -100 NS T/C M/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
7 100 -100 SYN C/T P/P 1000GP (YRI, YRI, YRI, YRI)
7 142,749,695 142,749,695 SYN C/T P/P rs61997195 (DbSNP)
7 142,749,723 142,749,723 NS A/G M/V rs60614398 (DbSNP)
7 142,749,737 142,749,737 SYN C/T Y/Y rs17164103 (DbSNP)
7 142,749,748 142,749,747 Ins(1) -/C rs34389632 (DbSNP)
7 142,749,919 142,749,919 NS A/G Q/R rs28563993 (DbSNP)
7 142,749,928 142,749,928 NS C/T P/L rs61736210 (DbSNP)
7 142,749,953 142,749,953 SYN C/T I/I rs11975892 (DbSNP)
7 142,750,147 142,750,147 NS C/T S/F rs10245778 (DbSNP)
7 142,750,243 142,750,243 NS A/G K/R rs7791886 (DbSNP)
7 142,750,304 142,750,304 SYN C/T T/T rs4725609 (DbSNP)
7 142,750,321 142,750,321 NS C/T A/V rs7779316 (DbSNP)
7 142,750,355 142,750,355 SYN A/G L/L rs7792047 (DbSNP)
7 143,052,640 143,052,640 SYN C/T Y/Y 1000GP (CEU, CHBJPT)
7 143,052,822 143,052,822 NS G/A R/Q 1000GP (CEU)
7 143,052,856 143,052,856 SYN C/T I/I 1000GP (CEU, CHBJPT)
7 143,053,050 143,053,050 NS C/T S/F 1000GP (CEU)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M1T R129C R161Q L164P S237F R269K V295A % Freq CORP
1 M R R L S R V 78.96 0.160
2 M R R L F R V 8.29 0.230
3 M R Q L S R V 7.22 0.160
4 M R R P S K V 2.23 0.160
5 M R R P S K A 1.84 0.160
6 T R R P S K V 0.84 1.200
7 M C R L S R V 0.15 0.160
8 M R R P S R V 0.15 0.160
9 M R R L S K V 0.15 0.160
10 M C Q L S R V 0.08 0.160
11 T R R L S K V 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6V1.aApr07-unspliced main_exon CDS chr7 143,052,341 143,053,279 +
3UTR chr7 143,053,279 143,053,282 +