Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7D4 Olfactory Receptor

Gene Symbol OR7D41 (View this gene in GeneCards)
Family 7
Subfamily D
Pseudogene No
CORP pseudogene probability score
Aliases hg105, OR19-B, OR19-7, HsOR19.2.11
External Ids HGNC: 8380   GeneBank: AB065929, AF399429, BK004226, NM_001005191   
Build #39 labels OR7D4P
Chromosomal location 19:9,213,902-9,214,837 (-)
Cluster 19@9b
Synteny CLIC#42
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7D1P 90.03% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7D4 82% 312
Chimp CONTIG875.22-10190 98% 312
Mouse Or7d41 78% 312
Rat Or7d41 76% 312
Cow OR7D2 70% 311

Expression evidences

Source Accession
ESTs CR747147
mRNA BC137162
GNF Atlas2 gnf1h09749_x_at

Sequence information

Nucleotide sequence ATGGAAGCAGAAAACCTTACAGAATTATCAAAATTTCTCCTCCTGGGACTCTCAGATGAT
CCTGAACTGCAGCCCGTCCTCTTTGGGCTGTTCCTGTCCATGTACCTGGTCACGGTGCTG
GGGAACCTGCTCATCATTCTGGCCGTCAGCTCTGACTCCCACCTCCACACCCCCATGTAC
TTCTTCCTCTCCAACCTGTCCTTTGTTGACATCTGTTTCATCTCCACCACAGTCCCCAAG
ATGCTAGTGAGCATCCAGGCACGGAGCAAAGACATCTCCTACATGGGGTGCCTCACTCAG
GTGTATTTTTTAATGATGTTTGCTGGAATGGATACTTTCCTACTGGCCGTGATGGCCTAT
GACCGGTTTGTGGCCATCTGCCACCCACTGCACTACACGGTCATCATGAACCCCTGCCTC
TGTGGCCTCCTGGTTCTGGCATCTTGGTTCATCATTTTCTGGTTCTCCCTGGTTCATATT
CTACTGATGAAGAGGTTGACCTTCTCCACAGGCACTGAGATTCCGCATTTCTTCTGTGAA
CCGGCTCAGGTCCTCAAGGTGGCCTGCTCTAACACCCTCCTCAATAACATTGTCTTGTAT
GTGGCCACGGCACTGCTGGGTGTGTTTCCTGTAGCTGGGATCCTCTTCTCCTACTCTCAG
ATTGTCTCCTCCTTAATGGGAATGTCCTCCACCAAGGGCAAGTACAAAGCCTTTTCCACC
TGTGGATCTCACCTCTGTGTGGTCTCCTTGTTCTATGGAACAGGACTTGGGGTCTATCTG
AGTTCTGCTGTGACCCATTCTTCCCAGAGCAGCTCCACCGCCTCAGTGATGTACGCCATG
GTCACCCCCATGCTGAACCCCTTCATCTACAGCCTGAGGAACAAGGATGTGAAGGGGGCC
CTGGAAAGACTCCTCAGCAGGGCCGACTCTTGTCCA
Conceptual translation MEAENLTELSKFLLLGLSDDPELQPVLFGLFLSMYLVTVLGNLLIILAVSSDSHLHTPMY
FFLSNLSFVDICFISTTVPKMLVSIQARSKDISYMGCLTQVYFLMMFAGMDTFLLAVMAY
DRFVAICHPLHYTVIMNPCLCGLLVLASWFIIFWFSLVHILLMKRLTFSTGTEIPHFFCE
PAQVLKVACSNTLLNNIVLYVATALLGVFPVAGILFSYSQIVSSLMGMSSTKGKYKAFST
CGSHLCVVSLFYGTGLGVYLSSAVTHSSQSSSTASVMYAMVTPMLNPFIYSLRNKDVKGA
LERLLSRADSCP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 9,325,465 9,325,465 NS A/G F/L rs57568862 (DbSNP)
19 9,325,116 9,325,116 NS A/G M/T rs5020278 (DbSNP)
19 9,325,099 9,325,099 NS A/G C/R rs5020276 (DbSNP)
19 9,325,290 9,325,290 NS C/G C/S rs5020281 (DbSNP)
19 9,325,121 9,325,121 NS C/G Q/H rs5020279 (DbSNP)
19 9,325,098 9,325,098 NS C/T C/Y rs5020275 (DbSNP)
19 9,325,263 9,325,263 NS C/T S/N rs5020280 (DbSNP)
19 9,325,106 9,325,106 NS C/T M/I rs5020277 (DbSNP)
19 9,325,278 9,325,278 NS G/A P/L rs61732668 (DbSNP)
19 9,325,252 9,325,252 NS G/A R/W rs61729907 (DbSNP)
19 9,324,640 9,324,640 NS G/T L/M rs4564704 (DbSNP)
19 9,325,097 9,325,097 SYN A/G C/C rs5020274 (DbSNP)
19 9,324,590 9,324,590 SYN A/G A/A rs10419202 (DbSNP)
19 9,324,863 9,324,863 SYN A/G S/S rs8109935 (DbSNP)
19 9,324,758 9,324,758 SYN G/A Y/Y rs61732676 (DbSNP)
19 9,214,440 9,214,440 NS G/A T/M 1000GP (CEU, CHBJPT)
19 9,214,576 9,214,576 NS G/A R/W 1000GP (CHBJPT)
19 100 -100 SYN G/A A/A 1000GP (YRI, YRI)
19 100 -100 NS G/A T/M 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 115 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

K232E G227R T133M R88W S84N P79L % Freq CORP
1 K G T R S P 79.19 0.080
2 K G M W S P 16.44 0.080
3 K G T R S L 2.84 0.192
4 K G T R N P 1.15 0.080
5 K R T R S P 0.15 0.080
6 E G T R S P 0.08 0.080
7 K G T W S L 0.08 0.192
8 K G M R S P 0.08 0.080

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7D4.aApr07-unspliced main_exon 3UTR chr19 9,213,899 9,213,902 -
CDS chr19 9,213,902 9,214,837 -