Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E29P Olfactory Receptor

Gene Symbol OR7E29P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases OST032, HsOR3.5.2P, ORL3102
External Ids HGNC: 8401   GeneBank: AF399389, NG_004130   ORDB: ORL3102   
Build #39 labels OR7E29P
Chromosomal location 3:125,712,125-125,713,069 (+)
Cluster 3@125
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E109P 92.09% 316
OR7E31P 91.43% 315
OR7E36P 90.88% 318

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 72% 309
Chimp OR7E36P 90% 318
Chimp OR7E33P 87% 316
Chimp OR7E31P 89% 316
Mouse Or7e178 69% 304
Rat Or7e173 65% 307
Cow OR7E186 72% 301
Orang OR7E14P 88% 315
Orang OR7E15P 90% 315
Horse OR7E225 72% 308

Expression evidences

Source Accession
ESTs BG205993

Sequence information

Nucleotide sequence TGCCCAATCTCTACAGACCCACAGAATCTAACAGATGTCTCTATATTCCTCCTCCTAGAA
CCTCAGAGGATCCAGAACGGCAGCTGGTCCTTGCTGGGCTGTTCCTGTCCATGTGCCTGG
TCACGGTGCTGGGGAACCTGATCATCATCCTGGACGTCAGCCCTGACTCCCACCTCCCCA
CCCCCATGTACTTCTTCCTCTCCAACCTGTCCTTGCCTGACATCGGTTTCACCTCCACCA
CGGTCCCCAAGATGATTGTGGACATCCAATCTCACGGCAGAGTCATCTTCTATGCAGGCT
GCCTGACTCAGATGTCTCTCTTTGCCATTTTTGGAGGCATGGAAGAGAGACACGCTCCTG
AGTGTGATGGCCTATGACCGGTTTGTAGCCATCTGTCACCCTCTATGTCATTCAGCCAGC
ATGAACCCGTGTTTCTGTGGCTTTCTAGTTTTGTTGTCTTTTTTTTTTCTCAGTCTTTTA
GACACCCAGCTGCACAACTTGATTGCCTTACAAATGACCTGCTTCAAGGATGTGGAAATT
CTTAATTTCTTCTGTGACCCTTCTCAACTCCCCCATCTTGCATGTTGTGACACCTTCACC
AATAACATAATCATGTATTTCCCTGCTGCCATATTTGGTTTTCTTCAGATCTCGGGGACC
CTTTTCTCTTACTATAAAATTGTTTCCTCCATTCTGAGGGTTTCATCATCAGGTGGGAAC
TATAAAGCCTTCTCCACCTGTGGGTCTCACCTGTCAGTTGTTTGCTGATTTTATGGAACA
GGCGTTGGAGGGTACCTCAGTTCAGATGTGTCATCTTCCCCGAGAAAGGGTGCAGTGGCC
TCAGTGATGTACACGGTGGTCACCCCCATGCTGAACCCCTTCATCTACAGCCTGAGAAAC
GGGGATATTAAAAGTGTTCTGCGGCGGCCGCAAGGCAGCAAGGTC
Conceptual translation CPISTDPQNLTDVSIFLLLE/SEDPERQLVLAGLFLSMCLVTVLGNLIIILDVSPDSHL
PTPMYFFLSNLSLPDIGFTSTTVPKMIVDIQSHGRVIFYAGCLTQMSLFAIFGGMEE\T
LLSVMAYDRFVAICHPLCHSASMNPCFCGFLVLLSFFFLSLLDTQLHNLIALQMTCFKDV
EILNFFCDPSQLPHLACCDTFTNNIIMYFPAAIFGFLQISGTLFSYYKIVSSILRVSSSG
GNYKAFSTCGSHLSVVCXYGTGVGGYLSSDVSSSPRKGAVASVMYTVVTPMLNPFIYSL
RNGDIKSVLRRPQGSKV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 125,418,471 125,418,471 large insertion 21926bp insertion rs72495111 (DbSNP)
3 125,431,505 125,431,505 SNP A/C rs1054439 (DbSNP)
3 125,431,752 125,431,752 SNP A/G rs1054457 (DbSNP)
3 125,431,767 125,431,767 SNP A/G rs16834477 (DbSNP)
3 125,431,244 125,431,244 SNP A/G rs2976761 (DbSNP)
3 125,430,974 125,430,974 SNP A/T rs72491237 (DbSNP)
3 125,431,673 125,431,673 SNP A/T rs2976762 (DbSNP)
3 125,431,790 125,431,790 SNP C/G rs17838817 (DbSNP)
3 125,431,747 125,431,747 SNP C/G rs1054455 (DbSNP)
3 125,431,541 125,431,541 SNP C/T rs62271873 (DbSNP)
3 125,431,751 125,431,751 SNP C/T rs1054456 (DbSNP)
3 125,431,510 125,431,510 SNP C/T rs2947714 (DbSNP)
3 125,431,886 125,431,886 SNP C/T rs2976763 (DbSNP)
3 125,431,396 125,431,396 SNP C/T rs9754922 (DbSNP)
3 125,431,305 125,431,305 SNP G/T rs72485367 (DbSNP)
3 125,712,552 125,712,552 SNP C/T 1000GP (CEU, CHBJPT)
3 100 -100 SNP C/T 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
3 125,399,139 125,465,506 CopyNumber Variation_68444 (DGV)
3 125,416,714 125,645,185 CopyNumber Variation_91514 (DGV)
3 125,416,714 125,474,884 CopyNumber Variation_91515 (DGV)
CopyNumber 66 (Hasin)
3 125,430,869 125,433,913 Deletion #283 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7E29P.aApr07 exon_5UTR chr3 125,604,654 125,604,854 +
exon_5UTR chr3 125,605,874 125,605,984 +
main_exon CDS_partial chr3 125,712,183 125,712,565 +