Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E39P Olfactory Receptor

Gene Symbol OR7E39P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases hg611, HsOR7.2.1P, ORL4085
External Ids HGNC: 8412   GeneBank: AF399377, NG_004294   ORDB: ORL4085   
Build #39 labels OR7E39P, OR7E138P
Chromosomal location 7:6,834,823-6,835,794 (-)
Cluster 7@7
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E36P 90.43% 324
OR7E37P 90.4% 323
OR7E38P 91.8% 317

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 71% 323
Mouse Or7e178 67% 310
Rat Or7e173 65% 306
Cow OR7E186 68% 323
Orang OR7E15P 87% 320
Orang OR7E14P 86% 320
Orang OR7E31DP 89% 297
Orang OR7E12P 84% 312
Horse OR7E225 69% 314
Chimp OR7E38P 90% 321
Chimp OR7E36P 88% 323
Chimp OR7E14P 87% 320

Expression evidences

Source Accession
GNF Atlas2 201973_s_at

Sequence information

Nucleotide sequence TTGCAACCCTCTTTTCTAGGCAAAAGGTATCCAAACTATGCAGAGCCACAGAATCTAACA
GATGTCTCTCTATTCCTTCTCCTAGAACTCTCAGGGGATCCAGAACTGCAGCTGGTCCTC
GCTGGGCTGTTCCTGTCCATCTGCCTGGTCATGGTGCTGGGGAACCTGCTCATCATCCTG
GCCATCAGCCCTGACTCCCACCTCCACACCCCCGTGTACTTCTTCCTCTCCAACCTGTCC
TTGCCTGACATCAGTTTCACCTCCACCACAGTCCCCAAGATGATTGTGGACATCCAATCT
CACAGCAGAGTCATCTCCTATGCAGGCTGCCTGACTCAGATGTCTCTCTTTGTCATTTTT
GGAGGCATGGAAGAGAGGCATGCTCCTGAGTGTGATGGCCTATGACTGGTTTGTAGCCAT
CTGTCACCCTCTATATCATTCAGCCATCATGAACCCGTGTTTCTGTGGCTTCCTAGTTTT
GTTGTCTTTTTTTTTCTCAGTCTTTTAGATGCCCAGCTGCACAACTTGATTGCCTTACAA
GTGACCTGCTTCAAGGATGTGGAAATTCCTAATTTCTTCTGTGACCCTTCTCAACTCCCC
CATCTTGCATGTTGTGACACCTTCACCATTAACATAATCATGTATTTCCCTGCCGCCATA
TTTGGTTTTCTTCCCATCTCGGGGACCCTTTTCTCTTACTCTAAAATTGTTTCCTCCATT
CTGAGGGTTTCATCGTCAGGTGGGAGGTATAAAGCCCTCTCCACCTGTGGGTCTCACCTG
TCAGTTGTTTGCTGAGTTTATGGAACAGGCGTTGGAGGGTACCTCAGTTCGGATGTGTCA
TTTTCCCCCAGAAAGGGTGCAGTGGCCTCAGTGATGTACGCGGTTGTCACCCCCATGCTG
AACCCCTTCGTCTACAGCCTGAGAAACAGGGATGTTAAAGGTGTCCTGCGGCGGCCACAC
GGCAGCACAGTC
Conceptual translation LQPSFLGKRYPNYAEPQNLTDVSLFLLLELSGDPELQLVLAGLFLSICLVMVLGNLLIIL
AISPDSHLHTPVYFFLSNLSLPDISFTSTTVPKMIVDIQSHSRVISYAGCLTQMSLFVIF
GGMEE\MLLSVMAYDWFVAICHPLYHSAIMNPCFCGFLVLL/FFFLSLLDAQLHNLIA
LQVTCFKDVEIPNFFCDPSQLPHLACCDTFTINIIMYFPAAIFGFLPISGTLFSYSKIVS
SILRVSSSGGRYKALSTCGSHLSVVCXYGTGVGGYLSSDVSFSPRKGAVASVMYAVVTP
MLNPFVYSLRNRDVKGVLRRPHGSTV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
7 100 -100 SNP T/C 1000GP (YRI, YRI, YRI, YRI)
7 6,834,858 6,834,858 SNP T/C 1000GP (CEU, CHBJPT)
7 6,835,647 6,835,647 SNP C/G 1000GP (CEU, CHBJPT)
7 6,835,792 6,835,792 SNP C/G 1000GP (CEU, CHBJPT)
7 6,874,489 6,874,489 SNP C/T rs73333165 (DbSNP)
7 6,874,648 6,874,648 SNP C/G rs13233326 (DbSNP)
7 6,874,691 6,874,691 SNP C/T rs56962619 (DbSNP)
7 6,874,714 6,874,714 SNP A/T rs62442278 (DbSNP)
7 6,875,116 6,875,117 Del(2) -/CT rs34551370 (DbSNP)
7 6,875,118 6,875,119 Del(2) -/CT rs56902949 (DbSNP)
7 6,875,174 6,875,174 SNP C/G rs4724861 (DbSNP)
7 6,875,176 6,875,176 SNP C/T rs4724862 (DbSNP)
7 6,875,212 6,875,212 SNP C/T rs4724863 (DbSNP)
7 6,875,278 6,875,278 SNP C/G rs13234838 (DbSNP)
7 6,875,423 6,875,423 SNP C/G rs7778535 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 72 (Hasin)
7 6,687,733 7,773,841 CopyNumber Variation_8546 (DGV)
7 6,750,772 6,990,043 InversionBreakpoint Variation_0842 (DGV)
7 6,764,583 6,977,214 CopyNumber Variation_2673 (DGV)
7 6,872,454 6,875,525 CopyNumber #112 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.