Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7E97P Olfactory Receptor

Gene Symbol OR7E97P1 (View this gene in GeneCards)
Family 7
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR3.5.5P, ORL3105
External Ids HGNC: 14834   GeneBank: NG_002256   ORDB: ORL3105   
Build #39 labels OR7E97P
Chromosomal location 3:125,747,075-125,748,109 (+)
Cluster 3@125
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7E129P 90.06% 342
OR7E8P 90.64% 342
OR7E93P 93.33% 345

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7E24 64% 331
Mouse Or7e178 61% 310
Rat Or7e173 57% 310
Cow OR7E186 63% 329
Orang OR7E103P 88% 307
Orang OR7E103BP 86% 301
Horse OR7E225 65% 318
Chimp OR7E163MP 88% 320
Chimp OR7E161P 87% 320
Chimp OR7E163BP 85% 320

Expression evidences

Source Accession
ESTs AA219029

Sequence information

Nucleotide sequence CTGGTTTTTATCTTTTATTTTTCCAATCCTCTTTCCTTCTCAAGGTGTCCAAGACACACA
GAGCCACGGAATCTCACAGGTGTCTGAGAATTCCTCCTCCTGGGACTCTCAGAGGATCCA
GAACTGCAGCCGGTCCTCGCTTTGCTGTCCCTGTCCCTGTCCATGTATCTGGTCACAGTG
CTGAGGAACCTGCTCAGCATCCCGGCTGTCAGCTCTGACTCCCACCTCCACACCCCCACG
TACTTCTTCCTCTCCATCCTGTGCTGGGCTGACATCGGTTTCACCTCGGCCACGGTTCCC
AAGATGATTGTGGACATGCAGTGGTATAGCAGAGTCATCTCTCATGCGGGCTGCCTGACA
CAGATGTCTTTCTTGGTCCTTTTTGCATGTATAGAAGGCATGCTCCTGACTGTAATGGCC
TATGACTGCTTTGTAGGCATCTATCGCCCTCTGCACTACCCAGTCATCGTGAATCCTCAT
CTCTGTGTCTTCTTTGTTTTGGTGTCCTTTTTCCTTAGCCTGTTGGATTCCCAGCTGCAC
AGTTGGATTGTGTTACAATTCACCATCATCAAGAATGTGGAAATCTCTAATTTTGTCTGT
GACCCCTCTCAACTTCTCAAACTTGCCTCTTATGACAGCGTCATCAATAGCATATTCATA
TATTTCGATAGTACAATGTTTGGTTTTCTTCCTATTTCAGGGATCCTTTCATCTTACTAT
AAAATTGTCCCCTCCATTCTAAGGATGTCATCGTCAGATGGGAAGTATAAAACTTTCTCC
ACCTATGGCTCTCACCTAGCATTTGTTTGCTGATTTTATGGAACAGGCATTGACATGTAC
CTGGCTTCAGCTATGTCACCAACCCCCAGGAATGGTGTGGTGGTGTCAGTGATGTAAGCT
GTGGTCACCCCCATGCTGAACCTTTTCATCTACAGCCTGAGAAACAGGGACATACAAAGT
GCCCTGCGGAGGCTGCGCAGCAGAACAGTCGAATCTCATGATCTGTTCCATCCTTTTTCT
GGTGTGGGTGAGAAA
Conceptual translation LVFIFYFSNPLSFSRCPRHTEPRNLTGVXFLLLGLSEDPELQPVLALLSLSLSMYLVTV
LRNLLSIPAVSSDSHLHTPTYFFLSILCWADIGFTSATVPKMIVDMQWYSRVISHAGCLT
QMSFLVLFACIEGMLLTVMAYDCFVGIYRPLHYPVIVNPHLCVFFVLVSFFLSLLDSQLH
SWIVLQFTIIKNVEISNFVCDPSQLLKLASYDSVINSIFIYFDSTMFGFLPISGILSSYY
KIVPSILRMSSSDGKYKTFSTYGSHLAFVCXYGTGIDMYLASAMSPTPRNGVVVSVMX
VVTPMLNLFIYSLRNRDIQSALRRLRSRTVESHDLFHPFSGVGEK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
3 100 -100 SNP A/G 1000GP (YRI, YRI, YRI)
3 125,466,094 125,466,094 SNP A/G rs56197323 (DbSNP)
3 125,466,205 125,466,204 Ins(1) -/G rs35802670 (DbSNP)
3 125,466,215 125,466,214 Ins(1) -/C rs34015868 (DbSNP)
3 125,466,331 125,466,331 SNP A/G rs9757184 (DbSNP)
3 125,466,360 125,466,360 SNP G/A rs2684964 (DbSNP)
3 125,466,495 125,466,495 SNP A/T rs4679465 (DbSNP)
3 125,466,636 125,466,636 SNP A/C rs9850805 (DbSNP)
3 125,466,801 125,466,801 SNP C/T rs9833444 (DbSNP)
3 125,466,946 125,466,946 SNP C/T rs72963777 (DbSNP)
3 125,747,785 125,747,785 SNP A/G 1000GP (CEU)
3 125,747,793 125,747,793 SNP A/C 1000GP (CEU, CHBJPT)
3 125,747,907 125,747,907 SNP A/G 1000GP (CEU, CHBJPT)
3 125,747,908 125,747,908 SNP C/T 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
3 125,416,714 125,474,884 CopyNumber Variation_91515 (DGV)
3 125,416,714 125,645,185 CopyNumber Variation_91514 (DGV)
3 125,465,818 125,468,952 Deletion #311 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.