Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7H1P Olfactory Receptor

Gene Symbol OR7H1P1 (View this gene in GeneCards)
Family 7
Subfamily H
Pseudogene Yes
CORP pseudogene probability score
Aliases CIT-B-440L2, OR19-15, HsOR19.2.17P, ORL3790
External Ids HGNC: 8468   GeneBank: AF399427, BK004758, NG_002205   ORDB: ORL3790   
Build #39 labels OR7H1P
Chromosomal location 19:9,278,433-9,279,369 (-)
Cluster 19@9b
Synteny CLIC#42
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7A5 65.45% 301
OR7C1 64.52% 310
OR7D4 66.45% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7H5P 78% 314
Mouse Or7h8 72% 309
Rat Or7h7b 73% 309
Cow OR7H5P 76% 312
Orang OR7H1 91% 312
Horse OR7H9 77% 312
Chimp OR7H1 96% 312

Sequence information

Nucleotide sequence ATGGACTTGGGAAATCAAACAAGAGTTTCAGAATTTTTACTCCTGGGATTTTCCCAAGAC
CTAGAGGATCAACAGTTGCTCTTTGCACTGTTTCTGTCCATGTACCTGGTCACCGTTCTG
GGGAACCTGCTCATCATCCTGGCCATCAGCTCTGACTCCCACCTCCACACCCCCAGGTAC
TTCTTCCTCTCCAATCTGTCCCTGGCTGACATCGGTTTCACCTCCACCGCAGTCCCCAAG
ATGCTGGTGAACATCCAGGTGCAGAGCAATGCCATCAGCTATGCAGACTGCATCGCCCAG
ATGTATGTTTTTCATGGTTTTTGGAGGCATGGACACATTTCTCCTCACCGTGATGGCCTA
TGACCGGTATGTGGCCATCTGTCACCCCCTGTACTACTGTGTCACCAGGAACCCCTGCCT
CTGTGGCCTGCTGGTTCTTGTGTCCTGGTTCCTCAGCTTGTCATACTCCCTGATCCAGAG
TCTGTTGGTGCTGCGGGTGTCCTTCTGCACCAGTTGAGTCATTCAGCACTTTTACTGTGA
GCTTGCTCAGGTCCTCAGGCTTACCTGCTCAGACACACATGTCAATTACATCCTGCTCTA
CGTGGTGGCCGGCCTTCTGGACTTTGTGCCCTTCTCAGGGATCCTTTTCTCCTACACCCA
AATTGTCTCCTACATCCTGAGAATCTCATCCACAGATGGGAAACACAAAGCCTTTTCTAC
CTGTGGATCTCATCTGTTTGTGGTTTCTTTATTCTATGGGACAGGCCTTGGTGTGTATCT
TAGTTCCAATGCATCGTCCTCTTCCTGGTGGGGCATGGTGGCCTCGGTCATGTACACTGT
GGTCACCCCCATGCTGAACCCCTTCATCTATTGCTTGCGGAACAGGGACATCAAGAGGAC
CCTAGAAACACTGCTTGGGAGAATGCTGTATGCTCAA
Conceptual translation MDLGNQTRVSEFLLLGFSQDLEDQQLLFALFLSMYLVTVLGNLLIILAISSDSHLHTPRY
FFLSNLSLADIGFTSTAVPKMLVNIQVQSNAISYADCIAQMY\FMVFGGMDTFLLTVMA
YDRYVAICHPLYYCVTRNPCLCGLLVLVSWFLSLSYSLIQSLLVLRVSFCTSXIQHFYC
ELAQVLRLTCSDTHVNYILLYVVAGLLDFVPFSGILFSYTQIVSYILRISSTDGKHKAFS
TCGSHLFVVSLFYGTGLGVYLSSNASSSSWWGMVASVMYTVVTPMLNPFIYCLRNRDIKR
TLETLLGRMLYAQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 9,389,182 9,389,181 Ins(1) -/A rs34361886 (DbSNP)
19 9,389,231 9,389,231 SNP A/T rs61742060 (DbSNP)
19 9,389,818 9,389,818 SNP G/A rs61733894 (DbSNP)
19 9,389,284 9,389,284 SNP G/A rs61741070 (DbSNP)
19 9,279,005 9,279,005 SNP G/A 1000GP (CEU)
19 9,279,027 9,279,027 SNP G/A 1000GP (CEU)
19 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
19 9,387,109 9,390,145 CopyNumber #100 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.