Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8A1 Olfactory Receptor

Gene Symbol OR8A11 (View this gene in GeneCards)
Family 8
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.1 (functional)
Aliases OR11-318, OST025, HsOR11.18.42, ORL3332
External Ids HGNC: 8469   GeneBank: AB065833, AF399512, AY726592, BK004495, NM_001005194   ORDB: ORL3332   
Build #39 labels OR8A1
Chromosomal location 11:124,570,120-124,571,046 (+)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8A2P 74.92% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8A1 89% 309
Chimp CONTIG*********** 99% 309
Mouse Or8a1b 85% 309
Mouse Or8a1-ps 85% 309
Rat Or8a1b 87% 309
Rat Or8a1 87% 309
Cow OR8A1 89% 309
Cow OR8A1C 86% 308
Cow OR8A1D 86% 307
Cow OR8A1E 84% 309
Cow OR8A1G 85% 309
Cow OR8A1F 84% 305
Cow OR8A1H 82% 311

Expression evidences

Source Accession
ESTs CR746755
mRNA AY726592

Sequence information

Nucleotide sequence ATGGCTGCAGGAAATCACTCTACAGTGACAGAGTTCATTCTCAAGGGTTTAACGAAGAGA
GCAGACCTCCAGCTCCCCCTCTTTCTCCTCTTCCTCGGGATCTACTTGGTCACCATCGTG
GGGAACCTGGGCATGATCACTCTAATTTGTCTGAACTCTCAGCTGCACACCCCCATGTAC
TACTTTCTCAGCAATCTGTCACTCATGGATCTCTGCTACTCCTCCGTCATTACCCCTAAG
ATGCTGGTGAACTTTGTGTCAGAGAAAAACATCATCTCCTACGCAGGGTGCATGTCACAG
CTCTACTTCTTCCTTGTTTTTGTCATTGCTGAGTGTTACATGCTGACAGTGATGGCCTAC
GACCGCTATGTTGCCATCTGCCACCCTTTGCTTTACAACATCATTATGTCTCATCACACC
TGCCTGCTGCTGGTGGCTGTGGTCTACGCCATCGGACTCATTGGCTCCACAATAGAAACT
GGCCTCATGTTAAAACTGCCCTATTGTGAGCACCTCATCAGTCACTACTTCTGTGACATC
CTCCCTCTCATGAAGCTGTCCTGCTCTAGCACCTATGATGTTGAGATGACAGTCTTCTTT
TCGGCTGGATTCAACATCATAGTCACGAGCTTAACAGTTCTTGTTTCTTACACCTTCATT
CTCTCCAGCATCCTCGGCATCAGCACCACAGAGGGGAGATCCAAAGCCTTCAGCACCTGC
AGCTCCCACCTTGCAGCCGTGGGAATGTTCTATGGATCAACTGCATTCATGTACTTAAAA
CCCTCCACAATCAGTTCCTTGACCCAGGAGAATGTGGCCTCTGTGTTCTACACCACGGTA
ATCCCCATGTTGAATCCCCTAATCTACAGCCTGAGGAACAAGGAAGTAAAGGCTGCCGTG
CAGAAAACGCTGAGGGGTAAACTGTTT
Conceptual translation MAAGNHSTVTEFILKGLTKRADLQLPLFLLFLGIYLVTIVGNLGMITLICLNSQLHTPMY
YFLSNLSLMDLCYSSVITPKMLVNFVSEKNIISYAGCMSQLYFFLVFVIAECYMLTVMAY
DRYVAICHPLLYNIIMSHHTCLLLVAVVYAIGLIGSTIETGLMLKLPYCEHLISHYFCDI
LPLMKLSCSSTYDVEMTVFFSAGFNIIVTSLTVLVSYTFILSSILGISTTEGRSKAFSTC
SSHLAAVGMFYGSTAFMYLKPSTISSLTQENVASVFYTTVIPMLNPLIYSLRNKEVKAAV
QKTLRGKLF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 124,440,389 124,440,389 NS A/C D/A rs61750763 (DbSNP)
11 124,440,241 124,440,241 NS A/G I/V rs61756691 (DbSNP)
11 124,440,043 124,440,043 NS A/G T/A rs7927196 (DbSNP)
11 124,440,362 124,440,362 NS C/G T/R rs55861866 (DbSNP)
11 124,440,617 124,440,617 NS C/T S/L rs12792184 (DbSNP)
11 124,440,923 124,440,923 NS C/T T/M rs59034440 (DbSNP)
11 124,440,078 124,440,078 SYN A/G A/A rs61748615 (DbSNP)
11 124,440,297 124,440,297 SYN C/T Y/Y rs61748716 (DbSNP)
11 124,440,132 124,440,132 SYN C/T I/I rs61753590 (DbSNP)
11 124,570,721 124,570,721 NS C/T S/L 1000GP (CEU, CHBJPT)
11 124,570,466 124,570,466 NS C/G T/R 1000GP (CEU, CHBJPT)
11 100 -100 SYN C/T I/I 1000GP (YRI)
11 100 -100 NS G/A V/I 1000GP (YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 135 (Hasin)
11 124,439,916 124,442,942 CopyNumber #84 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T27A V93I K97E T133R A142D V317M T320M % Freq CORP
1 T V K T A V T 67.59 0.972
2 T V K R A V T 27.50 0.972
3 T V K T A V M 1.46 0.972
4 T I K T A V T 1.38 0.972
5 T V K T A M T 1.00 0.972
6 A V K T A V T 0.77 0.972
7 T V E T A V M 0.15 0.972
8 A V K T A V M 0.08 0.972
9 T V K T D V T 0.08 0.972

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8A1.aApr07-unspliced main_exon 5UTR chr11 124,570,069 124,570,120 +
CDS chr11 124,570,120 124,571,046 +
3UTR chr11 124,571,046 124,571,372 +
OR8A1.bApr07 main_exon CDS_partial chr11 124,570,193 124,571,035 +
exon_3UTR chr11 124,578,049 124,578,289 +
exon_3UTR chr11 124,582,909 124,582,942 +