Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8B12 Olfactory Receptor

Gene Symbol OR8B121 (View this gene in GeneCards)
Family 8
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR11-317, HsOR11.18.41, ORL3333
External Ids HGNC: 15307   GeneBank: AB065834, AF399511, BK004494, NM_001005195   ORDB: ORL3333   
Build #39 labels OR8B12
Chromosomal location 11:124,542,725-124,543,654 (-)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8B10P 80.39% 311
OR8B8 80.06% 311
OR8B9P 80.06% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8B12 84% 310
Dog OR8B8 82% 310
Dog OR8B9 81% 311
Dog OR8B9B 82% 287
Chimp CONTIG*********** 97% 310
Mouse Or8b12c 83% 310
Mouse Or8b8 84% 310
Rat Or8b12 86% 310
Rat Or8b12c 82% 311
Rat Or8b8 83% 310
Rat Or8b12d 85% 310
Cow OR8B12 82% 306
Cow OR8B8 80% 310
Cow OR8B9 82% 311
Cow OR8B9C 81% 311

Expression evidences

Source Accession
mRNA BC136864

Sequence information

Nucleotide sequence ATGGCAGCCAAAAACTCTTCTGTGACAGAGTTTATCCTCGAAGGCTTAACCCACCAGCCG
GGACTGCGGATCCCCCTCTTCTTCCTGTTTCTGGGTTTCTACACGGTCACCGTGGTGGGG
AACCTGGGCTTGATAACCCTGATTGGGCTGAACTCTCACCTGCACACTCCCATGTACTTC
TTCCTTTTTAACCTCTCTTTAATAGATTTCTGTTTCTCCACTACCATCACTCCCAAAATG
CTGATGAGTTTTGTCTCAAGGAAGAACATCATTTCCTTCACAGGGTGTATGACTCAGCTC
TTCTTCTTCTGCTTCTTTGTCGTCTCTGAGTCCTTCATCCTGTCAGCGATGGCGTATGAC
CGCTACGTGGCCATCTGTAACCCACTGTTGTACACAGTCACCATGTCTTGCCAGGTGTGT
TTGCTCCTTTTGTTGGGTGCCTATGGGATGGGGTTTGCTGGGGCCATGGCCCACACAGGA
AGCATAATGAACCTGACCTTCTGTGCTGACAACCTTGTCAATCATTTCATGTGTGACATC
CTTCCTCTCCTTGAGCTCTCCTGCAACAGCTCTTACATGAATGAGCTGGTGGTCTTTATT
GTGGTGGCTGTTGACGTTGGAATGCCCATTGTCACTGTCTTTATTTCTTATGCCCTCATC
CTCTCCAGCATTCTACACAACAGTTCTACAGAAGGCAGGTCCAAAGCCTTTAGTACTTGC
AGTTCCCACATAATTGTAGTTTCTCTTTTCTTTGGTTCTGGTGCTTTCATGTATCTCAAA
CCCCTTTCCATCCTGCCCCTCGAGCAAGGGAAAGTGTCCTCCCTGTTCTATACCATAATA
GTCCCCGTGTTAAACCCATTAATCTATAGCTTGAGGAACAAGGATGTCAAAGTTGCCCTG
AGGAGAACTTTGGGCAGAAAAATCTTTTCT
Conceptual translation MAAKNSSVTEFILEGLTHQPGLRIPLFFLFLGFYTVTVVGNLGLITLIGLNSHLHTPMYF
FLFNLSLIDFCFSTTITPKMLMSFVSRKNIISFTGCMTQLFFFCFFVVSESFILSAMAYD
RYVAICNPLLYTVTMSCQVCLLLLLGAYGMGFAGAMAHTGSIMNLTFCADNLVNHFMCDI
LPLLELSCNSSYMNELVVFIVVAVDVGMPIVTVFISYALILSSILHNSSTEGRSKAFSTC
SSHIIVVSLFFGSGAFMYLKPLSILPLEQGKVSSLFYTIIVPVLNPLIYSLRNKDVKVAL
RRTLGRKIFS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 124,412,860 124,412,859 Ins(1) -/A rs34165015 (DbSNP)
11 124,413,261 124,413,261 NS A/T M/K rs61743861 (DbSNP)
11 124,412,730 124,412,730 NS G/A S/F rs61745407 (DbSNP)
11 124,412,838 124,412,838 NS T/C N/S rs61747005 (DbSNP)
11 124,413,248 124,413,248 SYN G/A F/F rs61743599 (DbSNP)
11 124,413,491 124,413,491 SYN T/C P/P rs61746453 (DbSNP)
11 124,412,747 124,412,747 SYN T/C E/E rs61745404 (DbSNP)
11 124,542,942 124,542,942 NS C/T S/N 1000GP (CEU)
11 100 -100 NS G/A S/F 1000GP (YRI, YRI, YRI)
11 100 -100 SYN C/T E/E 1000GP (YRI, YRI, YRI)
11 100 -100 nonsense SNP A/C Y/* 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S274F S238N M97K % Freq CORP
1 S S M 91.55 0.116
2 S N M 4.99 0.171
3 F S M 2.15 0.116
4 S S K 1.31 0.116

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8B12.aApr07-unspliced main_exon 3UTR chr11 124,542,722 124,542,725 -
CDS chr11 124,542,725 124,543,654 -