Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8B8 Olfactory Receptor

Gene Symbol OR8B81 (View this gene in GeneCards)
Family 8
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases OR11-316, HSTPCR85, JCG8, HsOR11.18.36, ORL3422
External Ids HGNC: 8477   GeneBank: AB065832, AF238488, AF399510, BK004496, HSTPCR85P, NM_012378   ORDB: ORL3422   
Build #39 labels OR8B8
Chromosomal location 11:124,440,153-124,441,085 (-)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8B10P 72.67% 311
OR8B12 80.06% 311
OR8B9P 76.24% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8B8 88% 311
Chimp CONTIG497.53-36780 98% 311
Mouse Or8b8 86% 311
Rat Or8b8 86% 311
Cow OR8B8 87% 311

Expression evidences

Source Accession
mRNA X89675
GNF Atlas2 gnf1h02117_at

Sequence information

Nucleotide sequence ATGGCTGCTGAGAATTCCTCCTTCGTGACACAGTTTATCCTCGCAGGCTTAACTGACCAA
CCGGGAGTCCAGATCCCCCTCTTCTTCCTGTTTCTAGGCTTCTACGTGGTCACTGTGGTG
GGGAACCTGGGCTTGATAACCCTGATAAGGCTCAACTCTCACTTGCACACCCCTATGTAC
TTCTTCCTCTATAACTTGTCCTTCATAGATTTCTGCTATTCCAGTGTTATCACTCCCAAA
ATGCTGATGAGCTTTGTCTTAAAGAAGAACAGCATCTCCTACGCAGGGTGTATGACTCAG
CTCTTCTTCTTTCTTTTCTTTGTTGTCTCTGAGTCCTTCATCCTGTCAGCAATGGCGTAT
GACCGCTATGTGGCCATCTGTAACCCACTGTTGTACATGGTCACCATGTCTCCCCAGGTG
TGTTTTCTCCTTTTGTTGGGTGTCTATGGGATGGGGTTTGCTGGGGCCATGGCCCACACA
GCGTGCATGATGGGTGTGACCTTCTGTGCCAATAACCTTGTCAACCACTACATGTGTGAC
ATCCTTCCCCTTCTTGAGTGTGCTTGCACCAGCACCTATGTGAATGAGCTTGTAGTGTTT
GTTGTTGTGGGCATTGATATTGGTGTGCCCACAGTCACCATCTTCATTTCCTATGCTCTC
ATTCTCTCCAGCATCTTCCACATTGATTCCACGGAGGGCAGGTCCAAAGCCTTCAGCACC
TGCAGCTCCCACATAATTGCAGTTTCTCTGTTCTTTGGGTCAGGAGCATTCATGTACCTC
AAACCCTTTTCTCTTTTAGCTATGAACCAGGGCAAGGTGTCTTCCCTATTCTATACCACT
GTGGTGCCCATGCTCAACCCATTAATTTATAGCCTGAGGAATAAGGACGTCAAAGTTGCT
CTAAAGAAAATCTTGAACAAAAATGCATTCTCC
Conceptual translation MAAENSSFVTQFILAGLTDQPGVQIPLFFLFLGFYVVTVVGNLGLITLIRLNSHLHTPMY
FFLYNLSFIDFCYSSVITPKMLMSFVLKKNSISYAGCMTQLFFFLFFVVSESFILSAMAY
DRYVAICNPLLYMVTMSPQVCFLLLLGVYGMGFAGAMAHTACMMGVTFCANNLVNHYMCD
ILPLLECACTSTYVNELVVFVVVGIDIGVPTVTIFISYALILSSIFHIDSTEGRSKAFST
CSSHIIAVSLFFGSGAFMYLKPFSLLAMNQGKVSSLFYTTVVPMLNPLIYSLRNKDVKVA
LKKILNKNAFS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SYN C/T A/A 1000GP (YRI)
11 124,310,318 124,310,318 NS A/G F/L rs1893135 (DbSNP)
11 124,310,406 124,310,406 SYN A/G T/T rs11606970 (DbSNP)
11 124,310,618 124,310,618 NS G/A R/C rs61733267 (DbSNP)
11 124,310,622 124,310,622 SYN A/G Y/Y rs4296049 (DbSNP)
11 124,310,692 124,310,692 NS C/T C/Y rs61912424 (DbSNP)
11 124,310,752 124,310,752 NS A/T I/N rs72472248 (DbSNP)
11 124,440,174 124,440,174 SYN G/A I/I 1000GP (CHBJPT)
11 124,440,377 124,440,377 NS C/T A/T 1000GP (CEU)
11 124,440,603 124,440,603 SYN C/G A/A 1000GP (CEU)
11 124,440,726 124,440,726 SYN A/G Y/Y 1000GP (CEU, CHBJPT)
11 124,440,856 124,440,856 NS A/T I/N 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 124,308,049 124,311,081 Deletion #234 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S291I F238I L222F R122C % Freq CORP
1 S F L R 99.00 0.140
2 S F L C 0.38 0.743
3 S F F R 0.38 0.140
4 I F L R 0.15 0.140
5 S I L R 0.08 0.229

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8B8.aApr07-unspliced main_exon 3UTR chr11 124,440,126 124,440,153 -
CDS chr11 124,440,153 124,441,085 -
5UTR chr11 124,441,085 124,441,158 -