Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8D2 Olfactory Receptor

Gene Symbol OR8D21 (View this gene in GeneCards)
Family 8
Subfamily D
Pseudogene No
CORP pseudogene probability score
Aliases AC002556-E, JCG2, OR11-303, HsOR11.18.27, ORL1026
External Ids HGNC: 8482   GeneBank: AF162668, AF162669, BK004202, NM_001002918   ORDB: ORL1026   
Build #39 labels OR8D2
Chromosomal location 11:124,319,265-124,320,197 (-)
Cluster 11@124
Synteny CLIC#29
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs2512219)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8A1 65.26% 308
OR8D1 70.13% 308
OR8G2P 64.36% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8D2 84% 308
Chimp CONTIG*********** 97% 311
Mouse Or8d2 85% 307
Mouse Or8d2b 82% 307
Rat Or8d2c-ps 83% 309
Rat Or8d2-ps 83% 309
Cow OR8D2P 84% 308

Expression evidences

Source Accession
mRNA AF162668
GNF Atlas2 gnf1h05807_at

Sequence information

Nucleotide sequence ATGGCTACTTCAAACCATTCTTCAGGGGCTGAGTTTATCCTGGCAGGCTTGACACAACGC
CCAGAACTTCAACTGCCACTCTTCCTCCTGTTCCTTGGAATATATGTGGTCACAGTGGTG
GGGAACCTGGGCATGATCTTCTTAATTGCTCTCAGTTCTCAACTTTACCCTCCAGTGTAT
TATTTTCTCAGTCATTTGTCTTTCATTGATCTCTGCTACTCCTCTGTCATTACCCCTAAG
ATGCTGGTGAACTTTGTTCCAGAGGAGAACATTATCTCCTTTCTGGAATGCATTACTCAA
CTTTATTTCTTCCTTATTTTTGTAATTGCAGAAGGCTACCTTCTGACAGCCATGGAATAT
GACCGTTATGTTGCTATCTGTCGCCCACTGCTTTACAATATTGTCATGTCCCACAGGGTC
TGTTCCATAATGATGGCTGTGGTATACTCACTGGGTTTTCTGTGGGCCACAGTCCATACT
ACCCGCATGTCAGTGTTGTCATTCTGTAGGTCTCATACGGTCAGTCATTATTTTTGTGAT
ATTCTCCCCTTATTGACTCTGTCTTGCTCCAGCACCCACATCAATGAGATTCTGCTGTTC
ATTATTGGAGGAGTTAATACCTTAGCAACTACACTGGCGGTCCTTATCTCTTATGCTTTC
ATTTTCTCTAGTATCCTTGGTATTCATTCCACTGAGGGGCAATCCAAAGCCTTTGGCACT
TGTAGCTCCCATCTCTTGGCTGTGGGCATCTTTTTTGGGTCTATAACATTCATGTATTTC
AAGCCCCCTTCCAGCACTACTATGGAAAAAGAGAAGGTGTCTTCTGTGTTCTACATCACA
ATAATCCCCATGCTGAATCCTCTAATCTATAGCCTGAGGAACAAGGATGTGAAAAATGCA
CTGAAGAAGATGACTAGGGGAAGGCAGTCATCC
Conceptual translation MATSNHSSGAEFILAGLTQRPELQLPLFLLFLGIYVVTVVGNLGMIFLIALSSQLYPPVY
YFLSHLSFIDLCYSSVITPKMLVNFVPEENIISFLECITQLYFFLIFVIAEGYLLTAMEY
DRYVAICRPLLYNIVMSHRVCSIMMAVVYSLGFLWATVHTTRMSVLSFCRSHTVSHYFCD
ILPLLTLSCSSTHINEILLFIIGGVNTLATTLAVLISYAFIFSSILGIHSTEGQSKAFGT
CSSHLLAVGIFFGSITFMYFKPPSSTTMEKEKVSSVFYITIIPMLNPLIYSLRNKDVKNA
LKKMTRGRQSS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A P/L 1000GP (YRI, YRI, YRI)
11 124,189,306 124,189,306 NS A/G L/P rs2466620 (DbSNP)
11 124,189,729 124,189,729 NS T/C H/R rs2512219 (DbSNP)
11 124,189,971 124,189,971 SYN C/T G/G rs7127554 (DbSNP)
11 124,190,036 124,190,036 NS G/A R/C rs61735123 (DbSNP)
11 124,319,396 124,319,396 NS T/C M/V 1000GP (CHBJPT)
11 124,319,410 124,319,410 NS G/A P/L 1000GP (CEU, CHBJPT)
11 124,319,833 124,319,833 NS C/T R/H 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M268V P263L R122H R20C % Freq CORP
1 M P R R 74.81 0.758
2 M L H R 20.74 0.982
3 M P H R 1.92 0.982
4 M L H C 1.54 0.982
5 V L H R 0.54 0.982
6 M P H C 0.31 0.982
7 M P R C 0.08 0.758
8 M L R R 0.08 0.758

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8D2.aApr07-unspliced main_exon 3UTR chr11 124,319,262 124,319,265 -
CDS chr11 124,319,265 124,320,197 -