Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8J1 Olfactory Receptor

Gene Symbol OR8J11 (View this gene in GeneCards)
Family 8
Subfamily J
Pseudogene No
CORP pseudogene probability score
Aliases OR11-183, HsOR11.11.62, ORL3447
External Ids HGNC: 14855   GeneBank: AB065748, AF399515, BK004340, NM_001005205   ORDB: ORL3447   
Build #39 labels OR8J1
Chromosomal location 11:56,360,247-56,361,194 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8J3 88.61% 316

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8J3 82% 310
Chimp CONTIG229.24-13605 97% 316
Mouse Or8j3 84% 316
Mouse Or8j3b 80% 314
Rat Or8j3 83% 315
Cow OR8J3 82% 316
Cow OR8J3F 81% 314
Cow OR8J3EP 81% 314

Expression evidences

Source Accession
mRNA BC137067

Sequence information

Nucleotide sequence ATGGCTCCTGAAAATTTCACCAGAGTCACTGAGTTTATTCTTACAGGTGTCTCTAGCTGT
CCAGAGCTCCAGATTCCCCTCTTCCTGGTCTTTCTGGTGCTCTATGGGCTGACCATGGCA
GGGAACCTGGGCATCATCACCCTCACCAGTGTTGACTCTCGACTTCAAACCCCCATGTAC
TTTTTCCTGCAACATCTGGCTCTCATTAATCTTGGTAACTCTACTGTCATTGCCCCTAAA
ATGCTGATTAACTTTTTAGTAAAGAAGAAAACTACCTCATTCTATGAATGTGCCACCCAA
CTGGGAGGGTTCTTGTTCTTTATTGTATCGGAGGTAATCATGCTGGCTTTGATGGCCTAT
GACCGCTATGTGGCTATTTGTAACCCTCTGCTGTACATGGTGGTGGTGTCTCGGCGGCTC
TGCCTCCTGCTGGTCTCCCTCACATACCTCTATGGCTTTTCTACAGCTATTGTGGTTTCA
TCTTATGTATTCTCTGTGTCTTATTGCTCTTCTAATATAATCAATCATTTTTACTGTGAT
AATGTTCCTCTGTTAGCATTATCTTGCTCTGATACTTACTTACCAGAAACAGTTGTCTTT
ATATCTGCAGCAACAAATGTGGTTGGTTCCTTGATTATAGTTCTAGTATCTTATTTCAAT
ATTGTTTTGTCTATTTTAAAAATATGTTCATCAGAAGGAAGGAAAAAAGCCTTTTCTACC
TGTGCTTCACATATGATGGCAGTCACAATTTTTTATGGGACATTGCTATTCATGTATGTG
CAGCCCCGAAGTAACCATTCACTGGATACTGATGATAAGATGGCTTCTGTGTTTTACACG
TTGGTAATTCCTATGCTGAATCCCTTGATCTACAGCCTGAGGAATAAGGATGTGAAGACT
GCTCTACAGAGATTCATGACAAATCTGTGCTATTCCTTTAAAACAATG
Conceptual translation MAPENFTRVTEFILTGVSSCPELQIPLFLVFLVLYGLTMAGNLGIITLTSVDSRLQTPMY
FFLQHLALINLGNSTVIAPKMLINFLVKKKTTSFYECATQLGGFLFFIVSEVIMLALMAY
DRYVAICNPLLYMVVVSRRLCLLLVSLTYLYGFSTAIVVSSYVFSVSYCSSNIINHFYCD
NVPLLALSCSDTYLPETVVFISAATNVVGSLIIVLVSYFNIVLSILKICSSEGRKKAFST
CASHMMAVTIFYGTLLFMYVQPRSNHSLDTDDKMASVFYTLVIPMLNPLIYSLRNKDVKT
ALQRFMTNLCYSFKTM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 56,128,406 56,128,406 NS A/G I/M rs62001032 (DbSNP)
11 56,128,081 56,128,081 NS A/G Y/C rs10896290 (DbSNP)
11 56,128,062 56,128,062 NS A/T M/L rs7942730 (DbSNP)
11 56,127,898 56,127,898 NS C/T T/M rs62001035 (DbSNP)
11 56,127,829 56,127,829 NS G/T G/V rs7927015 (DbSNP)
11 56,127,971 56,127,971 NS G/T M/I rs62001034 (DbSNP)
11 56,127,746 56,127,746 SYN A/G R/R rs7942390 (DbSNP)
11 56,128,524 56,128,524 SYN C/T L/L rs7928704 (DbSNP)
11 56,128,226 56,128,226 SYN C/T Y/Y rs11823483 (DbSNP)
11 56,128,113 56,128,113 SYN C/T L/L rs62001033 (DbSNP)
11 56,360,605 56,360,605 NS A/G Y/C 1000GP (CEU, CHBJPT)
11 56,361,048 56,361,048 SYN C/T L/L 1000GP (CEU, CHBJPT)
11 56,360,586 56,360,586 NS A/T M/L 1000GP (CEU)
11 56,360,930 56,360,930 NS A/G I/M 1000GP (CEU)
11 56,360,270 56,360,270 SYN A/G R/R 1000GP (CEU, CHBJPT)
11 56,360,353 56,360,353 NS G/T G/V 1000GP (CEU)
11 100 -100 NS T/C M/T 1000GP (YRI, YRI)
11 100 -100 SYN C/T L/L 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 56,118,942 56,149,196 CopyNumber Variation_34979 (DGV)
11 56,122,078 56,147,627 CopyNumber Variation_34980 (DGV)
CopyNumber 9 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G36V V51A M59T I83M N84H M114L Y120C I228M M285L % Freq CORP
1 G V M I N M Y I M 68.13 0.827
2 G V M I N M C I M 24.88 0.827
3 V V M I N L Y M M 4.22 0.637
4 G V M I N M Y I L 0.69 0.827
5 G V T I N M Y I M 0.46 0.975
6 V V M I N M Y I M 0.38 0.827
7 G V M I N M Y M M 0.38 0.827
8 V V M M N L Y M M 0.23 0.637
9 G A M I N M Y I M 0.15 0.827
10 G V M I N M C M M 0.08 0.827
11 V V M I H L Y M M 0.08 0.637
12 G V M I N L C M M 0.08 0.637
13 G V M M N M Y I M 0.08 0.827
14 V V M I H M Y M M 0.08 0.827
15 V V M I N M Y M M 0.08 0.827

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8J1.aApr07-unspliced main_exon CDS chr11 56,360,247 56,361,194 +
3UTR chr11 56,361,194 56,361,197 +