Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8J3 Olfactory Receptor

Gene Symbol OR8J31 (View this gene in GeneCards)
Family 8
Subfamily J
Pseudogene No
CORP pseudogene probability score 0.7 (pseudogene)
Aliases OR11-173, HsOR11.11.48, ORL3329
External Ids HGNC: 15312   GeneBank: AB065841, AF399516, BK004346, NM_001004064   ORDB: ORL3329   
Build #39 labels OR8J3
Chromosomal location 11:56,136,774-56,137,718 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8J1 88.61% 316

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8J3 82% 309
Chimp CONTIG970.12-582 99% 315
Mouse Or8j3b 81% 313
Mouse Or8j3 84% 315
Mouse Or8j3c 81% 313
Rat Or8j3d 80% 313
Rat Or8j3b 80% 313
Rat Or8j3 83% 314
Cow OR8J3 83% 315
Cow OR8J3F 81% 313
Cow OR8J3EP 80% 313

Expression evidences

Source Accession
GNF Atlas2 gnf1h10850_at

Sequence information

Nucleotide sequence ATGGCTCCTGAAAATTTCACCAGGGTCACTGAGTTTATTCTCACAGGTGTCTCTAGCTGT
CCAGAGCTCCAGATTCCCCTCTTCCTGGTCTTCCTAGTGCTCTATGTGCTGACCATGGCA
GGGAACCTGGGCATCATCACCCTCACCAGTGTTGACTCTCGACTTCAAAACCCCATGTAC
TTTTTCCTGAGACATCTAGCTATCATCAATCTTGGCAACTCTACTGTCATTGCCCCTAAA
ATGCTGATGAACTTTTTAGTAAAGAAGAAAACTACCTCATTCTATGAATGTGCCACCCAA
CTGGGAGGGTTCTTGTTCTTTATTGTATCGGAGGTAATGATGCTGGCTGTGATGGCCTAT
GACCGCTATGTGGCCATTTGTAACCCTCTGCTCTACATGGTGGTGGTGTCTCGGCGGCTC
TGCCTCCTGCTGGTGTCCCTCACATACCTCTATGGCTTTTCTACAGCTATTGTGGTTTCA
CCTTGTATATTCTCTGTGTCTTATTGCTCTTCTAATATAATCAATCATTTTTACTGTGAT
ATTGCACCTCTGTTAGCATTATCTTGCTCTGATACTTACATACCAGAAACAATAGTCTTT
ATATCTGCAGCAACAAATTTGGTTTTTTCCATGATTACAGTTCTAGTATCTTATTTCAAT
ATTGTTTTGTCCATTCTAAGGATACGTTCACCAGAAGGAAGGAAAAAAGCCTTTTCCACC
TGCGCTTCGCATATGATAGCAGTCACGGTTTTCTATGGGACAATGCTATTTATGTATTTG
CAGCCCCAAACCAACCACTCACTGGATACTGATAAGATGGCTTCTGTGTTTTACACATTG
GTGATTCCTATGCTGAATCCCTTGATCTACAGCCTGAGGAATAATGATGTAAATGTTGCC
TTAAAGAAATTCATGGAAAATCCATGTTACTCCTTTAAATCAATG
Conceptual translation MAPENFTRVTEFILTGVSSCPELQIPLFLVFLVLYVLTMAGNLGIITLTSVDSRLQNPMY
FFLRHLAIINLGNSTVIAPKMLMNFLVKKKTTSFYECATQLGGFLFFIVSEVMMLAVMAY
DRYVAICNPLLYMVVVSRRLCLLLVSLTYLYGFSTAIVVSPCIFSVSYCSSNIINHFYCD
IAPLLALSCSDTYIPETIVFISAATNLVFSMITVLVSYFNIVLSILRIRSPEGRKKAFST
CASHMIAVTVFYGTMLFMYLQPQTNHSLDTDKMASVFYTLVIPMLNPLIYSLRNNDVNVA
LKKFMENPCYSFKSM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/C D/E 1000GP (YRI, YRI, YRI)
11 100 -100 SYN T/C T/T 1000GP (YRI)
11 55,904,328 55,904,328 SYN A/G I/I rs12280262 (DbSNP)
11 55,904,382 55,904,382 NS A/C D/E rs17150102 (DbSNP)
11 55,904,439 55,904,439 SYN G/A Y/Y rs61743520 (DbSNP)
11 55,904,573 55,904,573 NS A/C F/V rs1384094 (DbSNP)
11 55,904,751 55,904,751 SYN C/T T/T rs1947923 (DbSNP)
11 55,904,828 55,904,828 NS A/G Y/H rs11227321 (DbSNP)
11 55,904,832 55,904,832 SYN A/G D/D rs7936390 (DbSNP)
11 55,904,936 55,904,936 NS C/T V/I rs7937461 (DbSNP)
11 55,905,005 55,905,005 SYN G/T R/R rs7926893 (DbSNP)
11 55,905,025 55,905,025 NS G/T T/N rs1947924 (DbSNP)
11 55,905,078 55,905,078 NS T/C I/M rs61742348 (DbSNP)
11 55,905,099 55,905,099 SYN C/T L/L rs7927014 (DbSNP)
11 56,136,906 56,136,906 NS A/C D/E 1000GP (CEU, CHBJPT)
11 56,137,275 56,137,275 SYN T/C T/T 1000GP (CEU)
11 56,137,352 56,137,352 NS A/G Y/H 1000GP (CEU)
11 56,137,549 56,137,549 NS T/G N/T 1000GP (CEU)
11 56,137,602 56,137,602 NS C/T M/I 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 98 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

D271E M258T T205K Y123H N57T M39I L32V % Freq CORP
1 D M T Y N M L 81.57 0.827
2 E M T H N I L 9.68 0.757
3 D M T Y T M L 5.38 0.827
4 D T T Y N M L 2.23 0.827
5 D M K Y N M L 0.54 0.827
6 D M T Y N M V 0.31 0.827
7 E M T Y N I L 0.23 0.827
8 D M T H N I L 0.08 0.757

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8J3.aApr07-unspliced main_exon 3UTR chr11 56,136,771 56,136,774 -
CDS chr11 56,136,774 56,137,718 -