Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8K3 Olfactory Receptor

Gene Symbol OR8K31 (View this gene in GeneCards)
Family 8
Subfamily K
Pseudogene No
CORP pseudogene probability score
Aliases OR11-181, HsOR11.11.59, ORL3385
External Ids HGNC: 15313   GeneBank: AB065541, BK004338, NM_001005202   ORDB: ORL3385   
Build #39 labels OR8K3
Chromosomal location 11:56,318,307-56,319,242 (+)
Cluster 11@56
Synteny CLIC#26
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs960193)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR8K1 68.83% 308
OR8K5 70.03% 307
OR8V1P 74.19% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Chimp CONTIG970.5-2860 74% 310
Chimp CONTIG970.10-456 71% 286
Cow OR8K3B 79% 312
Cow OR8V29 81% 312
Cow OR8V33 82% 312

Sequence information

Nucleotide sequence ATGGAACAACACAATCTAACAACGGTGAATGAATTCATTCTTACGGGAATCACAGATATC
GCTGAGCTGCAGGCACCATTATTTGCATTGTTCCTCATGATCTATGTGATCTCAGTGATG
GGCAATTTGGGCATGATTGTCCTCACCAAGTTGGACTCCAGGTTGCAAACCCCTATGTAC
TTTTTTCTCAGACATCTGGCTTTCATGGATCTTGGTTATTCAACAACTGTGGGACCCAAA
ATGTTAGTAAATTTTGTTGTGGATAAGAATATAATTTCTTATTATTTTTGTGCAACACAG
CTAGCTTTCTTTCTTGTGTTCATTGGTAGTGAACTTTTTATTCTCTCAGCCATGTCCTAC
GACCTCTATGTGGCCATCTGTAACCCTCTGCTATACACAGTAATCATGTCACGAAGGGTA
TGTCAGGTGCTGGTAGCAATCCCTTACCTCTATTGCACATTCATTTCTCTTCTAGTCACC
ATAAAGATTTTTACTTTATCCTTCTGTGGCTACAACGTCATTAGTCATTTCTACTGTGAC
AGTCTCCCTTTGTTACCTTTGCTTTGTTCAAATACACATGAAATTGAATTGATAATTCTG
ATCTTTGCAGCTATTGATTTGATTTCATCTCTTCTGATAGTTCTTTTATCTTACCTGCTC
ATCCTTGTAGCCATTCTCAGGATGAATTCTGCTGGCAGACAAAAGGCTTTTTCTACCTGT
GGAGCCCACCTGACAGTGGTCATAGTGTTCTATGGGACTTTGCTTTTCATGTACGTGCAG
CCCAAGTCCAGTCATTCCTTTGACACTGATAAAGTGGCTTCCATATTTTACACCCTGGTT
ATCCCCATGTTGAATCCCTTGATCTATAGTTTACGAAACAAAGATGTAAAATATGCCCTA
CGAAGGACATGGAATAACTTATGTAATATTTTTGTT
Conceptual translation MEQHNLTTVNEFILTGITDIAELQAPLFALFLMIYVISVMGNLGMIVLTKLDSRLQTPMY
FFLRHLAFMDLGYSTTVGPKMLVNFVVDKNIISYYFCATQLAFFLVFIGSELFILSAMSY
DLYVAICNPLLYTVIMSRRVCQVLVAIPYLYCTFISLLVTIKIFTLSFCGYNVISHFYCD
SLPLLPLLCSNTHEIELIILIFAAIDLISSLLIVLLSYLLILVAILRMNSAGRQKAFSTC
GAHLTVVIVFYGTLLFMYVQPKSSHSFDTDKVASIFYTLVIPMLNPLIYSLRNKDVKYAL
RRTWNNLCNIFV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS T/G L/R 1000GP (YRI, YRI, YRI)
11 100 -100 SYN T/C Y/Y 1000GP (YRI)
11 56,086,147 56,086,147 NS T/G L/R rs960193 (DbSNP)
11 56,086,299 56,086,299 NS A/G I/V rs12291617 (DbSNP)
11 56,086,607 56,086,607 NS A/G I/M rs17150317 (DbSNP)
11 56,318,671 56,318,671 NS T/G L/R 1000GP (CEU, CHBJPT)
11 56,318,864 56,318,864 SYN T/C P/P 1000GP (CEU)
11 56,319,084 56,319,084 nonsense SNP C/T Q/* 1000GP (CEU)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L122R V173I Q260* I275M % Freq CORP
1 R V Q I 71.20 0.078
2 L V Q I 25.12 0.602
3 R I Q I 2.15 0.078
4 R V * I 0.84 1.200
5 R I Q M 0.69 0.078

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8K3.aApr07-unspliced main_exon CDS chr11 56,318,307 56,319,242 +
3UTR chr11 56,319,242 56,319,245 +