Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR8U1 Olfactory Receptor

Gene Symbol OR8U11 (View this gene in GeneCards)
Family 8
Subfamily U
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases HsOR11.11.63
External Ids HGNC: 19611   GeneBank: AB065603, NM_001005204   
Build #39 labels OR8U1
Chromosomal location 11:56,375,609-56,376,550 (+)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5R1 68.2% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR8U9 89% 309
Dog OR8U8 87% 310
Chimp CONTIG229.26-11956 92% 309
Chimp CONTIG*********** 90% 309
Mouse Or8u9 86% 309
Mouse Or8u8 84% 309
Rat Or8u8 85% 309
Rat Or8u9 85% 309
Cow OR8U1 84% 309
Cow OR8U9 84% 309
Cow OR8U1B 84% 309

Expression evidences

Source Accession
ESTs GD263286

Sequence information

Nucleotide sequence ATGGCCAGAAAAGATATGGCTCACATCAATTGCACCCAGGCGACAGAGTTTATTCTTGTG
GGCCTCACAGACCATCAGGAGTTGAAGATGCCCCTCTTTGTGCTATTCTTATCCATCTAC
CTCTTCACAGTGGTAGGCAACTTGGGTTTGATCCTACTCATTAGAGCGGATACAAGTCTC
AACACACCAATGTACTTCTTTCTTAGCAACCTAGCTTTTGTGGATTTCTGTTACTCTTCT
GTCATTACACCCAAAATGCTTGGGAATTTCTTGTACAAACAAAATGTTATATCCTTTGAT
GCATGTGCTACTCAACTGGGCTGCTTTCTCACCTTCATGATATCAGAATCCTTGCTACTG
GCTTCCATGGCCTATGACCGATATGTGGCCATTTGTAACCCTCTATTGTATATGGTTGTA
ATGACTCCAGGAATCTGCATTCAACTTGTAGCAGTTCCTTATAGCTATAGCTTCCTAATG
GCACTATTTCACACCATCCTCACCTTCCGCCTCTCCTATTGCCACTCCAACATTGTCAAC
CATTTCTATTGTGATGACATGCCTCTCCTCAGGCTAACTTGCTCAGACACTCGCTTCAAA
CAGCTCTGGATCTTTGCCTGTGCTGGTATCATGTTCATTTCCTCCCTTCTGATTGTCTTT
GTCTCCTACATGTTCATCATTTCTGCCATCCTGAGGATGCATTCAGCTGAGGGAAGACAG
AAGGCTTTCTCGACGTGTGGCTCTCACATGCTGGCAGTCACCATATTCTATGGGACCCTC
ATTTTTATGTACTTACAGCCTAGCTCTAGCCATGCCCTGGACACAGACAAGATGGCCTCT
GTCTTCTACACAGTGATCATTCCCATGTTGAATCCCTTAATCTATAGCCTCCAGAATAAG
GAGGTGAAAGAAGCTCTGAAGAAAATCATTATCAATAAAAAC
Conceptual translation MAHINCTQATEFILVGLTDHQELKMPLFVLFLSIYLFTVVGNLGLILLIRADTSLNTPMY
FFLSNLAFVDFCYSSVITPKMLGNFLYKQNVISFDACATQLGCFLTFMISESLLLASMAY
DRYVAICNPLLYMVVMTPGICIQLVAVPYSYSFLMALFHTILTFRLSYCHSNIVNHFYCD
DMPLLRLTCSDTRFKQLWIFACAGIMFISSLLIVFVSYMFIISAILRMHSAEGRQKAFST
CGSHMLAVTIFYGTLIFMYLQPSSSHALDTDKMASVFYTVIIPMLNPLIYSLQNKEVKEA
LKKIIINKN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/G H/Q 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN C/T D/D 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 56,143,156 56,143,156 SYN C/T D/D rs11228165 (DbSNP)
11 56,143,158 56,143,158 NS A/G H/R rs11228166 (DbSNP)
11 56,143,392 56,143,392 NS A/C D/A rs62623589 (DbSNP)
11 56,143,424 56,143,424 NS A/G I/V rs12788990 (DbSNP)
11 56,143,434 56,143,434 NS C/G S/C rs10791961 (DbSNP)
11 56,143,501 56,143,501 SYN G/T V/V rs12272237 (DbSNP)
11 56,143,508 56,143,508 NS A/T T/S rs10791962 (DbSNP)
11 56,143,510 56,143,510 SYN C/T T/T rs10791963 (DbSNP)
11 56,143,528 56,143,528 SYN A/G Q/Q rs10791964 (DbSNP)
11 56,143,570 56,143,570 SYN A/G L/L rs11228169 (DbSNP)
11 56,143,592 56,143,592 NS C/T R/C rs17150411 (DbSNP)
11 56,143,690 56,143,690 SYN A/C L/L rs4990123 (DbSNP)
11 56,143,696 56,143,696 SYN C/T I/I rs4990122 (DbSNP)
11 56,143,699 56,143,699 NS G/T L/F rs4990121 (DbSNP)
11 56,143,716 56,143,716 NS C/T T/M rs10896309 (DbSNP)
11 56,143,717 56,143,717 NS A/G I/M rs10896310 (DbSNP)
11 56,143,723 56,143,723 SYN C/T I/I rs12272349 (DbSNP)
11 56,143,729 56,143,729 SYN C/T S/S rs55888197 (DbSNP)
11 56,143,730 56,143,730 NS C/G L/V rs55860603 (DbSNP)
11 56,143,936 56,143,936 SYN A/G T/T rs72925527 (DbSNP)
11 56,143,942 56,143,942 SYN C/T I/I rs72925528 (DbSNP)
11 56,143,961 56,143,961 NS T/G L/V rs1573509 (DbSNP)
11 56,143,966 56,143,966 SYN C/T I/I rs12291978 (DbSNP)
11 56,143,968 56,143,968 NS A/G Y/C rs72925530 (DbSNP)
11 56,143,977 56,143,977 NS A/G Q/R rs12272403 (DbSNP)
11 56,375,619 56,375,619 NS A/G K/R 1000GP (CEU)
11 56,375,622 56,375,622 NS A/G D/G 1000GP (CEU)
11 56,375,627 56,375,627 NS G/A A/T 1000GP (CEU, CHBJPT)
11 56,375,632 56,375,632 NS C/G H/Q 1000GP (CEU, CHBJPT)
11 56,375,649 56,375,649 NS C/T A/V 1000GP (CEU, CHBJPT)
11 56,375,680 56,375,680 SYN C/T D/D 1000GP (CEU, CHBJPT)
11 56,375,682 56,375,682 NS A/G H/R 1000GP (CEU, CHBJPT)
11 56,375,722 56,375,722 SYN C/T S/S 1000GP (CEU)
11 56,375,728 56,375,728 SYN C/T Y/Y 1000GP (CEU)
11 56,375,731 56,375,731 SYN C/T L/L 1000GP (CEU)
11 56,375,740 56,375,740 SYN G/A V/V 1000GP (CEU, CHBJPT)
11 56,375,749 56,375,749 SYN C/T N/N 1000GP (CEU, CHBJPT)
11 56,375,750 56,375,750 SYN T/C L/L 1000GP (CEU, CHBJPT)
11 56,375,881 56,375,881 SYN G/A L/L 1000GP (CEU, CHBJPT)
11 56,375,884 56,375,884 SYN C/T Y/Y 1000GP (CEU, CHBJPT)
11 56,375,948 56,375,948 NS A/G I/V 1000GP (CEU, CHBJPT)
11 56,375,958 56,375,958 NS C/G S/C 1000GP (CEU)
11 56,376,013 56,376,013 SYN A/G L/L 1000GP (CEU, CHBJPT)
11 56,376,014 56,376,014 NS T/A L/M 1000GP (CEU, CHBJPT)
11 56,376,116 56,376,116 NS C/T R/C 1000GP (CEU)
11 56,376,286 56,376,286 SYN C/T I/I 1000GP (CEU, CHBJPT)
11 56,376,291 56,376,291 NS C/T S/F 1000GP (CEU, CHBJPT)
11 56,376,382 56,376,382 SYN G/C G/G 1000GP (CEU, CHBJPT)
11 56,376,388 56,376,388 SYN C/G L/L 1000GP (CEU, CHBJPT)
11 56,376,391 56,376,391 SYN T/C I/I 1000GP (CEU, CHBJPT)
11 56,376,430 56,376,430 SYN C/T D/D 1000GP (CHBJPT)
11 56,376,431 56,376,431 NS A/G T/A 1000GP (CHBJPT)
11 56,376,460 56,376,460 SYN A/G T/T 1000GP (CEU, CHBJPT)
11 56,376,466 56,376,466 SYN C/T I/I 1000GP (CEU, CHBJPT)
11 56,376,490 56,376,490 SYN C/T I/I 1000GP (CEU, CHBJPT)
11 56,376,492 56,376,492 NS A/G Y/C 1000GP (CEU)
11 56,376,501 56,376,501 NS A/G Q/R 1000GP (CEU, CHBJPT)
11 56,376,546 56,376,546 NS A/G K/R 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
Deletion 258 (Hasin)
11 56,118,942 56,149,196 CopyNumber Variation_34979 (DGV)
11 56,122,078 56,147,627 CopyNumber Variation_34980 (DGV)
11 56,137,843 56,150,075 CopyNumber Variation_34981 (DGV)
11 56,139,749 56,144,896 CopyNumber Variation_34982 (DGV)
11 56,141,284 56,145,321 CopyNumber Variation_34983 (DGV)
11 56,142,239 56,156,355 CopyNumber Variation_34984 (DGV)
11 56,142,985 56,146,026 CopyNumber #146 (Waszak)
11 56,143,570 56,143,571 CopyNumber Variation_41256 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

H3Q N5S A9V H20R T137S M206V M206T L211V S223F G242S % Freq CORP
1 H N A H T M M L S G 27.19 0.078
2 H N A R T M M L S G 20.58 0.078
3 H N V R T M M L S G 9.06 0.078
4 H N A H T M M L F G 6.37 0.078
5 H N A R T M M L F G 4.22 0.078
6 H N V R T M M L F G 3.99 0.078
7 H S A H T M M L S G 2.23 0.078
8 H N A H T M M L S S 1.84 0.078
9 Q N V R T M M L S G 1.77 0.078
10 H N A H S M M L S G 1.15 0.078
11 Q N V R T M M L F G 1.15 0.078
12 H N A H T M M L F S 1.08 0.078
13 H N A R T M M L F S 1.00 0.078
14 H S A H T M M L F G 1.00 0.078
15 H N V R T M M L S S 1.00 0.078
16 H N A R T M M L S S 0.92 0.078
17 H N V R T M M L F S 0.84 0.078
18 H N A H T V M L S G 0.77 0.078
19 H N V R S M M L F G 0.69 0.078
20 H N A R S M M L S G 0.69 0.078
21 H N V R T M M V F G 0.61 0.078
22 H N A H S M M L F G 0.61 0.078
23 H N V R S M M L S G 0.61 0.078
24 H N V H T M M L S G 0.61 0.078
25 Q N V H T M M L S G 0.54 0.078
26 H N A R S M M L F G 0.54 0.078
27 H N V R S M M L S S 0.54 0.078
28 H N V R S M M L F S 0.54 0.078
29 H S A H T M M L S S 0.46 0.078
30 H N A R T M M V F G 0.38 0.078
31 Q N V R S M M L F S 0.38 0.078
32 H N A R S M M L F S 0.38 0.078
33 Q N V H T M M L F G 0.31 0.078
34 H N A H T M M V F G 0.31 0.078
35 H S A H S M M L S G 0.31 0.078
36 Q N V R S M M L F G 0.31 0.078
37 H S V H T M M L S G 0.31 0.078
38 H N A H T M M V S G 0.31 0.078
39 Q N V R T M M L F S 0.23 0.078
40 H N V R T M M V F S 0.23 0.078
41 H N A H S M M L S S 0.23 0.078
42 Q N V R S M M L S G 0.23 0.078
43 H N V R S M M V S G 0.15 0.078
44 H N V R S M M V F S 0.15 0.078
45 Q N A H T M M L F G 0.15 0.078
46 H N A H S M M L F S 0.15 0.078
47 H N A R S M M V F S 0.15 0.078
48 H N A H S M M V F S 0.15 0.078
49 H N A R T M M V S G 0.15 0.078
50 H N V H T M M L S S 0.15 0.078
51 H N V R S M M V F G 0.15 0.078
52 Q N V R T M M V S G 0.15 0.078
53 H N V R T M M V S G 0.15 0.078
54 H S A H T M M V S G 0.08 0.078
55 Q N V R S M M V F G 0.08 0.078
56 H N V R T M M V S S 0.08 0.078
57 Q N V R S M M L S S 0.08 0.078
58 H N A R T M T L S S 0.08 0.078
59 Q N V R T M M V F S 0.08 0.078
60 H S V H T M M L F S 0.08 0.078
61 H N A H T M T L F S 0.08 0.078
62 Q N V R S M M V S G 0.08 0.078
63 H S A H S M M L F S 0.08 0.078
64 Q N V R T M M V S S 0.08 0.078
65 H N A H T M T L F G 0.08 0.078
66 Q N A H S M M L S G 0.08 0.078
67 Q N V H S M M L F S 0.08 0.078
68 Q N V H S M M L F G 0.08 0.078
69 H S A H S M M L F G 0.08 0.078
70 Q N V R T M M L S S 0.08 0.078
71 Q N V H S M M V F S 0.08 0.078
72 H N A R T M M V S S 0.08 0.078
73 H N V H S M M L F G 0.08 0.078
74 H N A H S M M V F G 0.08 0.078
75 H N A R S M M V S S 0.08 0.078
76 H S A H T M M L F S 0.08 0.078

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR8U8.aApr07-unspliced main_exon CDS_partial chr11 56,375,624 56,376,550 +
3UTR chr11 56,376,550 56,376,579 +