Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR9K2 Olfactory Receptor

Gene Symbol OR9K21 (View this gene in GeneCards)
Family 9
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.02 (functional)
Aliases OR12-2, HsOR12.5.2, ORL3656
External Ids HGNC: 15339   GeneBank: AB065862, BK004326, NM_001005243   ORDB: ORL3656   
Build #39 labels OR9K2
Chromosomal location 12:55,129,835-55,130,773 (+)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR9K1P 72.76% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR9K2 89% 313
Dog OR9K2C 86% 309
Dog OR9K2D 86% 309
Chimp CONTIG802.88-10676 98% 313
Mouse Or9k2 90% 310
Mouse Or9k2b 88% 313
Rat Or9k2 89% 311
Rat Or9k2b 89% 313
Cow OR9K2 87% 313
Cow OR9K2G 84% 313
Cow OR9K2FP 83% 317
Cow OR9K2DP 83% 309
Cow OR9K2C 84% 309
Cow OR9K2I 84% 310
Cow OR9K2H 86% 309
Cow OR9K2K 84% 309
Cow OR9K2J 83% 309

Expression evidences

Source Accession
mRNA BC136988
GNF Atlas2 gnf1h10486_at

Sequence information

Nucleotide sequence ATGGGTGACAGGGGAACAAGCAATCACTCAGAAATGACTGACTTCATTCTTGCAGGCTTC
AGGGTACGCCCAGAGCTCCACATTCTCCTCTTCCTGCTATTTTTGTTTGTTTATGCCATG
ATCCTTCTAGGGAATGTTGGGATGATGACCATTATTATGACTGATCCTCGGCTGAACACA
CCAATGTATTTTTTCCTAGGCAATCTCTCCTTCATTGATCTTTTCTATTCATCTGTTATT
GAACCCAAGGCTATGATCAACTTCTGGTCTGAAAACAAGTCTATCTCCTTTGCAGGCTGT
GTGGCCCAGCTCTTTCTCTTTGCCCTCCTCATTGTGACTGAGGGATTTCTCCTGGCGGCC
ATGGCTTATGACCGCTTTATTGCCATCTGCAACCCTCTGCTCTACTCTGTTCAAATGTCC
ACACGTCTGTGTACTCAGTTGGTGGCTGGTTCCTATTTTTGTGGCTGCATTAGCTCAGTT
ATTCAGACTAGCATGACATTTACTTTATCTTTTTGCGCTTCTCGGGCTGTTGACCACTTT
TACTGTGATTCTCGCCCACTTCAGAGACTGTCTTGTTCTGATCTCTTTATCCATAGAATG
ATATCTTTTTCCTTATCATGTATTATTATCTTGCCTACTATCATAGTCATTATAGTATCT
TACATGTATATTGTGTCCACAGTTCTAAAGATACATTCTACTGAGGGACATAAGAAGGCC
TTCTCCACCTGCAGCTCTCACCTGGGAGTTGTGAGTGTGCTGTATGGTGCTGTCTTTTTT
ATGTATCTCACTCCTGACAGATTTCCTGAGCTGAGTAAAGTGGCATCCTTATGTTACTCC
CTAGTCACTCCCATGTTGAATCCTTTGATTTACTCTCTGAGGAACAAAGATGTCCAAGAG
GCTCTAAAAAAATTTCTAGAGAAGAAAAATATTATTCTT
Conceptual translation MGDRGTSNHSEMTDFILAGFRVRPELHILLFLLFLFVYAMILLGNVGMMTIIMTDPRLNT
PMYFFLGNLSFIDLFYSSVIEPKAMINFWSENKSISFAGCVAQLFLFALLIVTEGFLLAA
MAYDRFIAICNPLLYSVQMSTRLCTQLVAGSYFCGCISSVIQTSMTFTLSFCASRAVDHF
YCDSRPLQRLSCSDLFIHRMISFSLSCIIILPTIIVIIVSYMYIVSTVLKIHSTEGHKKA
FSTCSSHLGVVSVLYGAVFFMYLTPDRFPELSKVASLCYSLVTPMLNPLIYSLRNKDVQE
ALKKFLEKKNIIL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 100 -100 NS C/T R/C 1000GP (YRI, YRI, YRI)
12 100 -100 SYN T/C H/H 1000GP (YRI)
12 55,129,901 55,129,901 NS C/T R/C 1000GP (CEU, CHBJPT)
12 55,130,011 55,130,011 SYN C/T N/N 1000GP (CEU)
12 55,130,076 55,130,076 NS A/C E/A 1000GP (CEU, CHBJPT)
12 55,130,351 55,130,351 NS G/A A/T 1000GP (CHBJPT)
12 55,130,388 55,130,388 NS G/A R/H 1000GP (CEU, CHBJPT)
12 55,130,530 55,130,530 SYN T/C H/H 1000GP (CEU, CHBJPT)
12 55,523,645 55,523,645 SYN C/T H/H rs57538856 (DbSNP)
12 55,523,685 55,523,685 NS C/T R/C rs12303066 (DbSNP)
12 55,523,860 55,523,860 NS A/C E/A rs7305779 (DbSNP)
12 55,524,172 55,524,172 NS A/G H/R rs7306491 (DbSNP)
12 55,524,314 55,524,314 SYN C/T H/H rs7137261 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R45C M84T E103A R147C A195T R207H G258V % Freq CORP
1 R M E R A R G 69.59 1.000
2 C M A R A H G 29.03 1.000
3 R M A R A H G 0.31 1.000
4 C M A R A H V 0.31 1.000
5 R T E R A R G 0.15 1.000
6 C M A R T H G 0.15 1.000
7 R M E C A R G 0.15 1.000
8 C M A R A R G 0.15 1.000
9 R M E R T R G 0.08 1.000
10 C M E R A H G 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR9K2.aApr07-unspliced main_exon 5UTR chr12 55,129,769 55,129,835 +
CDS chr12 55,129,835 55,130,773 +
3UTR chr12 55,130,773 55,130,776 +