Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR9Q1 Olfactory Receptor

Gene Symbol OR9Q11 (View this gene in GeneCards)
Family 9
Subfamily Q
Pseudogene No
CORP pseudogene probability score 0.31 (functional)
Aliases HsOR11.12.7, ORL3278
External Ids HGNC: 14724   GeneBank: AB065734, AF399532, NM_001005212   ORDB: ORL3278   
Build #39 labels OR9Q1
Chromosomal location 11:58,179,445-58,180,374 (+)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR9Q2 73.46% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR9Q4 77% 310
Chimp CONTIG229.242-15826 96% 310
Mouse Or9q1 83% 309
Rat Or9q1 82% 310
Cow OR9Q6 68% 311

Sequence information

Nucleotide sequence ATGGCAGAGATGAACCTCACCTTGGTGACCGAGTTCCTCCTTATTGCATTCACTGAATAT
CCTGAATGGGCACTCCCTCTCTTCCTCTTGTTTTTATTTATGTATCTCATCACCGTATTG
GGGAACTTAGAGATGATTATTCTGATCCTCATGGATCACCAGCTCCACGCTCCAATGTAT
TTCCTTCTGAGTCACCTCGCTTTCATGGACGTCTGCTACTCATCTATCACTGTCCCCCAG
ATGCTGGCAGTGCTGCTGGAGCATGGGGCAGCTTTATCTTACACACGCTGTGCTGCTCAG
TTCTTTCTGTTCACCTTCTTTGGTTCCATCGACTGCTACCTCTTGGCCCTCATGGCCTAT
GACCGCTACTTGGCTGTGTGCCAGCCCCTGCTTTATGTCACCATCCTGACACAGCAGGCC
CGCTTGAGTCTTGTGGCTGGGGCTTACGTTGCTGGTCTCATCAGTGCCTTGGTGCGGACA
GTCTCAGCCTTCACTCTCTCCTTCTGTGGAACCAGTGAGATTGACTTTATTTTCTGTGAC
CTCCCTCCTCTGTTAAAGTTGACCTGTGGGGAGAGCTACACTCAAGAAGTGCTGATTATT
ATGTTTGCCATTTTTGTCATCCCTGCTTCCATGGTGGTGATCTTGGTGTCCTACCTGTTT
ATCATCGTGGCCATCATGGGGATCCCTGCTGGAAGCCAGGCCAAGACCTTCTCCACCTGC
ACCTCCCACCTCACTGCTGTGTCACTCTTCTTTGGTACCCTCATCTTCATGTACTTGAGA
GGTAACTCAGATCAGTCTTCGGAGAAGAATCGGGTAGTGTCTGTGCTTTACACAGAGGTC
ATCCCCATGTTGAATCCCCTCATCTACAGCCTGAGGAACAAGGAAGTGAAGGAGGCCCTG
AGAAAAATTCTCAATAGAGCCAAGTTGTCC
Conceptual translation MAEMNLTLVTEFLLIAFTEYPEWALPLFLLFLFMYLITVLGNLEMIILILMDHQLHAPMY
FLLSHLAFMDVCYSSITVPQMLAVLLEHGAALSYTRCAAQFFLFTFFGSIDCYLLALMAY
DRYLAVCQPLLYVTILTQQARLSLVAGAYVAGLISALVRTVSAFTLSFCGTSEIDFIFCD
LPPLLKLTCGESYTQEVLIIMFAIFVIPASMVVILVSYLFIIVAIMGIPAGSQAKTFSTC
TSHLTAVSLFFGTLIFMYLRGNSDQSSEKNRVVSVLYTEVIPMLNPLIYSLRNKEVKEAL
RKILNRAKLS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SYN C/G A/A 1000GP (YRI)
11 57,947,264 57,947,264 SYN C/G A/A rs11229273 (DbSNP)
11 57,947,391 57,947,391 NS C/T R/W rs2513718 (DbSNP)
11 57,947,392 57,947,392 NS G/T R/L rs12420738 (DbSNP)
11 57,947,812 57,947,812 Del(1) -/C rs34509298 (DbSNP)
11 58,179,567 58,179,567 SYN G/T G/G 1000GP (CEU)
11 58,179,691 58,179,691 NS G/A A/T 1000GP (CEU)
11 58,179,792 58,179,792 SYN C/G A/A 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 229 (Hasin)
11 57,912,509 57,948,750 CopyNumber Variation_4745 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A83T M283I % Freq CORP
1 A M 97.70 0.418
2 T M 2.07 0.418
3 A I 0.23 0.418

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR9Q1.aApr07 exon_5UTR chr11 58,023,881 58,024,104 +
exon_5UTR chr11 58,055,870 58,055,947 +
main_exon 5UTR chr11 58,179,431 58,179,445 +
CDS chr11 58,179,445 58,180,374 +
3UTR chr11 58,180,374 58,181,564 +