Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10G6 Olfactory Receptor

Gene Symbol OR10G61 (View this gene in GeneCards)
Family 10
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.97 (pseudogene)
Aliases OR11-280, HsOR11.18.9
External Ids HGNC: 14836   GeneBank: AB065508, BK004312, NG_002255   
Build #39 labels OR10G6P
Chromosomal location 11:123,994,166-123,995,161 (-)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10G1P 61.28% 297
OR10G2 60.34% 295
OR10G3 58.86% 299

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10G6 91% 311
Chimp CONTIG497.5-2223 97% 329
Mouse Or10g6 90% 319
Rat Or10g1 60% 317
Cow OR10G6 87% 311

Expression evidences

Source Accession
mRNA AB529275
GNF Atlas2 gnf1h10675_at

Sequence information

Nucleotide sequence ATGTTAGAGGGTGTTGAGCATCTCCTTCTGCTACTTCTTTTGACAGATGTGAACAGCAAG
GAACTGCAAAGTGGAAACCAGACTTCTGTGTCTCACTTCATTTTGGTGGGCCTGCACCAC
CCACCACAGCTGGGAGCGCCACTCTTCTTAGCTTTCCTTGTCATCTATCTCCTCACTGTT
TCTGGAAATGGGCTCATCATCCTCACTGTCTTAGTGGACATCCGGCTCCATCGTCCCATG
TGCTTGTTCCTGTGTCACCTCTCCTTCTTGGACATGACCATTTCTTGTGCTATTGTCCCC
AAGATGCTGGCTGGCTTTCTCTTGGGTAGTAGGATTATCTCCTTTGGGGGCTGTGTAATC
CAACTATTTTCTTTCCATTTCCTGGGCTGTACTGAGTGCTTCCTTTACACACTCATGGCT
TATGACCGTTTCCTTGCCATTTGTAAGCCCTTACACTATGCTACCATCATGACCCACAGA
GTCTGTAACTCCCTGGCTTTAGGCACCTGGCTGGGAGGGACTATCCATTCACTTTTCCAA
ACAAGTTTTGTATTCCGGCTGCCCTTCTGTGGCCCCAATCGGGTCGACTACATCTTCTGT
GACATTCCTGCCATGCTGCGTCTAGCCTGCGCCGATACGGCCATCAACGAGCTGGTCACC
TTTGCAGACATTGGCTTCCTGGCCCTCACCTGCTTCATGCTCATCCTCACTTCCTATGGC
TATATTGTAGCTGCCATCCTGCGAATTCCGTCAGCAGATGGGCGCCGCAATGCCTTCTCC
ACTTGTGCTGCCCACCTCACTGTTGTCATTGTTTACTATGTGCCCTGCACCTTCATTTAC
CTGCGGCCTTGTTCACAGGAGCCCCTGGATGGGGTGGTAGCTGTCTTTTACACTGTCATC
ACTCCCTTGCTTAACTCCATCATCTACACACTGTGCAACAAAGAAATGAAGGCAGCATTA
CAGAGGCTAGGGGGCCACAAGGAAGTGCAGCCTCAC
Conceptual translation MLEGVEHLLLLLLLTDVNSKELQSGNQTSVSHFILVGLHHPPQLGAPLFLAFLVIYLLTV
SGNGLIILTVLVDIRLHRPMCLFLCHLSFLDMTISCAIVPKMLAGFLLGSRIISFGGCVI
QLFSFHFLGCTECFLYTLMAYDRFLAICKPLHYATIMTHRVCNSLALGTWLGGTIHSLFQ
TSFVFRLPFCGPNRVDYIFCDIPAMLRLACADTAINELVTFADIGFLALTCFMLILTSYG
YIVAAILRIPSADGRRNAFSTCAAHLTVVIVYYVPCTFIYLRPCSQEPLDGVVAVFYTVI
TPLLNSIIYTLCNKEMKAALQRLGGHKEVQPH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/T L/Q 1000GP (YRI)
11 100 -100 SYN G/A I/I 1000GP (YRI, YRI, YRI, YRI)
11 123,864,948 123,864,948 SYN A/G I/I rs17128086 (DbSNP)
11 123,865,086 123,865,086 SYN A/C T/T rs7944434 (DbSNP)
11 123,865,235 123,865,235 NS C/T D/N rs17128087 (DbSNP)
11 123,865,305 123,865,305 SYN A/G P/P rs10790622 (DbSNP)
11 123,865,504 123,865,504 NS A/T L/Q rs17128089 (DbSNP)
11 123,865,808 123,865,807 Ins(1) -/C rs35841023 (DbSNP)
11 123,865,815 123,865,815 SYN A/G N/N rs7127148 (DbSNP)
11 123,994,217 123,994,217 NS T/G E/D 1000GP (CEU)
11 123,994,241 123,994,241 SYN G/A I/I 1000GP (CEU, CHBJPT)
11 123,994,379 123,994,379 SYN A/C T/T 1000GP (CEU, CHBJPT)
11 123,994,598 123,994,598 SYN G/A P/P 1000GP (CEU, CHBJPT)
11 123,995,108 123,995,108 SYN G/A N/N 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 123,862,873 123,865,968 Deletion, CopyNumber #254 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

E315D F278L D212N C190S R186Q R186W C133F L122Q R78H M1T % Freq CORP
1 E F D C R R C L R M 96.47 0.986
2 E F D C R R C Q R M 1.15 0.986
3 E F D C R W C L R M 0.61 0.986
4 E L D C R R C L H T 0.54 1.200
5 E F D C Q R C L R M 0.46 0.986
6 E F N C R R C L R M 0.31 0.986
7 E F D S R R C L R M 0.15 0.986
8 E F D C R R F L R M 0.15 0.986
9 D F D C R R C L R M 0.08 0.986
10 E F N C R R C Q R M 0.08 0.986