Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10G7 Olfactory Receptor

Gene Symbol OR10G71 (View this gene in GeneCards)
Family 10
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR11-283, HsOR11.18.14, ORL3290
External Ids HGNC: 14842   GeneBank: AB065754, BK004314, NM_001004463   ORDB: ORL3290   
Build #39 labels OR10G7
Chromosomal location 11:124,038,069-124,039,001 (-)
Cluster 11@124
Synteny CLIC#29
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10G4 91.42% 303
OR10G8 88.1% 311
OR10G9 90.03% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10G7 85% 309
Dog OR10G7B 85% 311
Dog OR10G9C 87% 291
Dog OR10G9 87% 291
Chimp CONTIG*********** 96% 311
Mouse Or10g7 87% 311
Mouse Or10g9 85% 311
Mouse Or10g9b 84% 309
Rat Or10g7-ps 84% 311
Rat Or10g9 85% 309
Rat Or10g9b 84% 309
Cow OR10G9D 79% 311
Cow OR10G4P 82% 291
Cow OR10G4B 80% 291

Expression evidences

Source Accession
mRNA AB529276
GNF Atlas2 gnf1h05561_at

Sequence information

Nucleotide sequence ATGTCCAACGCCACCCTACTGACAGCGTTCATCCTCACGGGCCTTCCCCATGCCCCAGGG
CTGGACGCCCCCCTCTTTGGAATCTTCCTGGTGGTTTACGTGCTCACTGTGCTGGGGAAC
CTCCTCATCCTGCTGGTGATCAGGGTGGATTCTCACCTCCACACCCCCATGTACTACTTC
CTCACCAACCTGTCCTTCATTGACATGTGGTTCTCCACTGTCACGGTGCCCAAAATGCTG
ATGACCTTGGTGTCCCCAAGCGGCAGGACTATCTCCTTCCACAGCTGCGTGGCTCAGCTC
TATTTTTTCCACTTCCTGGGGAGCACCGAGTGTTTCCTCTACACAGTCATGTCCTATGAT
CGCTACCTGGCCATCAGTTACCCGCTCAGGTACACCAACATGATGACTGGGCGCTCGTGT
GCCCTCCTGGCCACCGGCACTTGGCTCAGTGGCTCTCTGCACTCTGCTGTCCAGACCATA
TTGACTTTCCATTTGCCCTACTGTGGACCCAACCAGATCCAGCACTACTTCTGTGACGCA
CCGCCCATCCTGAAACTGGCCTGTGCAGACACCTCAGCCAACGAGATGGTCATCTTTGTG
AATATTGGGCTAGTGGCCTCGGGCTGCTTTGTCCTGATAGTGCTGTCCTATGTGTCCATC
GTCTGTTCCATCCTGCGGATCCGCACCTCAGAGGGGAGGCACAGAGCCTTTCAGACCTGT
GCCTCCCACTGTATCGTGGTCCTTTGCTTCTTTGGCCCTGGTCTTTTCATTTACCTGAGG
CCAGGCTCCAGGGACGCCTTGCATGGGGTTGTGGCCGTTTTCTACACCACGCTGACTCCT
CTTTTCAACCCTGTTGTGTACACCCTGAGAAACAAGGAGGTAAAGAAAGCTCTGTTGAAG
CTGAAAAATGGGTCAGTATTTGCTCAGGGTGAA
Conceptual translation MSNATLLTAFILTGLPHAPGLDAPLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTPMYYF
LTNLSFIDMWFSTVTVPKMLMTLVSPSGRTISFHSCVAQLYFFHFLGSTECFLYTVMSYD
RYLAISYPLRYTNMMTGRSCALLATGTWLSGSLHSAVQTILTFHLPYCGPNQIQHYFCDA
PPILKLACADTSANEMVIFVNIGLVASGCFVLIVLSYVSIVCSILRIRTSEGRHRAFQTC
ASHCIVVLCFFGPGLFIYLRPGSRDALHGVVAVFYTTLTPLFNPVVYTLRNKEVKKALLK
LKNGSVFAQGE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A T/M 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/T P/P 1000GP (YRI)
11 123,909,049 123,909,049 SYN G/T I/I rs12291067 (DbSNP)
11 123,909,073 123,909,073 SYN C/G L/L rs11219419 (DbSNP)
11 123,909,099 123,909,099 NS G/T L/I rs59358830 (DbSNP)
11 123,909,172 123,909,172 SYN A/G D/D rs28414940 (DbSNP)
11 123,909,194 123,909,194 NS C/T R/Q rs55868851 (DbSNP)
11 123,909,302 123,909,302 NS C/G S/T rs513591 (DbSNP)
11 123,909,311 123,909,311 NS C/T S/N rs472442 (DbSNP)
11 123,909,342 123,909,342 SYN A/G L/L rs470242 (DbSNP)
11 123,909,441 123,909,441 NS T/C T/A rs470208 (DbSNP)
11 123,909,627 123,909,627 NS C/T V/I rs11219420 (DbSNP)
11 123,909,637 123,909,637 SYN G/T P/P rs4936889 (DbSNP)
11 123,909,650 123,909,650 NS C/G G/A rs3894199 (DbSNP)
11 123,909,653 123,909,653 NS G/T P/Q rs4998340 (DbSNP)
11 123,909,656 123,909,656 NS G/A A/V rs3894198 (DbSNP)
11 123,909,671 123,909,671 NS A/G M/T rs11827843 (DbSNP)
11 123,909,695 123,909,695 NS C/G S/T rs3894197 (DbSNP)
11 124,038,392 124,038,392 NS G/T L/I 1000GP (CHBJPT)
11 124,038,595 124,038,595 NS G/C T/S 1000GP (CHBJPT)
11 124,038,635 124,038,635 SYN G/A L/L 1000GP (CEU)
11 124,038,930 124,038,930 SYN G/T P/P 1000GP (CEU, CHBJPT)
11 124,038,988 124,038,988 NS G/C T/S 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
11 123,908,157 123,920,660 CopyNumber Variation_86062 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T277M L204I S192* R138H T136S N133S G20A P19Q A18V T13M T5S % Freq CORP
1 T L S R T N G P A T S 37.56 0.138
2 T L S R T N G P A T T 23.04 0.138
3 T L S R T N A Q V T S 15.44 0.138
4 T L S R T N G P A M T 7.07 0.138
5 T I S R T N G P A T S 6.61 0.138
6 T L S R S S A Q V T S 3.84 0.138
7 M L S R T N G P A T T 2.53 0.138
8 T L * R T N G P A T T 1.23 1.200
9 T L S R S S G P A T S 1.15 0.138
10 M L S R T N A Q V T S 0.23 0.138
11 M L S R T N G P A T S 0.23 0.138
12 T L S H T N G P A T T 0.23 0.138
13 T L * H T N A Q V T S 0.15 1.200
14 T I * R T N G P A T T 0.15 1.200
15 T I S R S S G P A T S 0.08 0.138
16 M L * R T N G P A T T 0.08 1.200
17 T L S R T N G P A M S 0.08 0.138
18 T I S R T N G P A T T 0.08 0.138
19 T L S R T S G P A T T 0.08 0.138
20 T L * H T N G P A T T 0.08 1.200
21 T L S R S S G Q V T S 0.08 0.138

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10G7.aApr07-unspliced main_exon 3UTR chr11 124,038,066 124,038,069 -
CDS chr11 124,038,069 124,039,001 -