Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11H4 Olfactory Receptor

Gene Symbol OR11H41 (View this gene in GeneCards)
Family 11
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.1 (functional)
Aliases OR14-36, HsOR14.1.29, ORL3686
External Ids HGNC: 15347   GeneBank: AB065887, BK004455, NM_001004479   ORDB: ORL3686   
Build #39 labels OR11H4
Chromosomal location 14:20,242,822-20,243,763 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR11H5P 68.01% 297
OR11H6 68.4% 307
OR11H7P 68.15% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11H4 87% 316
Chimp CONTIG*********** 98% 314
Mouse Or11h4 89% 313
Mouse Or11h4b 87% 313
Rat Or11h4c 84% 313
Rat Or11h4d 84% 313
Rat Or11h4 87% 313
Cow OR11H4 87% 314

Expression evidences

Source Accession
mRNA AB529289

Sequence information

Nucleotide sequence ATGAACAGGTCAGCAACACACATCGTGACAGAGTTTATTCTCCTGGGATTCCCTGGTTGC
TGGAAGATTCAGATTTTCCTCTTCTCATTGTTTTTGGTGATTTATGTCTTGACCTTGCTG
GGAAATGGAGCCATCATCTATGCAGTGAGATGCAACCCACTACTACACACCCCCATGTAC
TTTCTGCTGGGAAATTTTGCCTTCCTTGAGATCTGGTATGTGTCCTCCACTATTCCTAAC
ATGCTAGTCAACATTCTCTCCAAGACCAAGGCCATCTCATTTTCTGGGTGCTTCCTCCAG
TTCTATTTCTTCTTTTCACTGGGAACAACTGAATGTCTCTTTCTGGCAGTAATGGCTTAT
GATCGATACCTGGCCATCTGCCACCCACTGCAGTACCCTGCCATCATGACTGTAAGGTTC
TGTGGTAAGCTGGTGTCTTTCTGTTGGCTTATTGGATTCCTTGGATACCCAATTCCCATT
TTCTACATCTCCCAACTCCCCTTCTGTGGTCCTAATATCATTGATCACTTCCTGTGTGAC
ATGGACCCATTGATGGCTCTATCCTGTGCCCCAGCTCCCATAACTGAATGTATTTTCTAT
ACTCAGAGCTCCCTTGTCCTCTTTTTCACTAGTATGTACATTCTTCGATCCTATATCCTG
TTACTAACAGCTGTTTTTCAGGTCCCTTCTGCAGCTGGTCGGAGAAAAGCCTTCTCTACC
TGTGGTTCTCATTTGGTTGTGGTATCTCTTTTCTATGGGACAGTCATGGTAATGTATGTA
AGTCCTACATATGGGATCCCAACTTTATTGCAGAAGATCCTCACACTGGTATATTCAGTA
ACGACTCCTCTTTTTAATCCTCTGATCTATACTCTTCGTAATAAGGACATGAAACTCGCT
CTGAGAAATGTCCTGTTTGGAATGAGAATTCGTCAAAATTCG
Conceptual translation MNRSATHIVTEFILLGFPGCWKIQIFLFSLFLVIYVLTLLGNGAIIYAVRCNPLLHTPMY
FLLGNFAFLEIWYVSSTIPNMLVNILSKTKAISFSGCFLQFYFFFSLGTTECLFLAVMAY
DRYLAICHPLQYPAIMTVRFCGKLVSFCWLIGFLGYPIPIFYISQLPFCGPNIIDHFLCD
MDPLMALSCAPAPITECIFYTQSSLVLFFTSMYILRSYILLLTAVFQVPSAAGRRKAFST
CGSHLVVVSLFYGTVMVMYVSPTYGIPTLLQKILTLVYSVTTPLFNPLIYTLRNKDMKLA
LRNVLFGMRIRQNS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 nonsense SNP T/A Y/* 1000GP (YRI)
14 100 -100 NS G/A R/Q 1000GP (YRI, YRI)
14 20,243,310 20,243,310 SYN C/T I/I 1000GP (CHBJPT)
14 20,243,522 20,243,522 NS G/A R/Q 1000GP (CEU)
14 20,243,693 20,243,693 NS C/G T/S 1000GP (CEU)
14 20,711,344 20,711,344 NS C/G R/G rs45438498 (DbSNP)
14 20,711,811 20,711,811 SYN A/G V/V rs17277263 (DbSNP)
14 20,711,852 20,711,852 NS C/G T/S rs17277270 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Y57* V59A F108L D192H R244Q T301S % Freq CORP
1 Y V F D R T 90.94 0.964
2 Y V F D R S 7.91 0.964
3 * V F D R T 0.46 1.200
4 Y A F D R T 0.23 0.964
5 Y V F D Q T 0.23 0.964
6 Y V L D R T 0.15 0.964
7 Y V F H R T 0.08 0.964

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR11H4.aApr07-unspliced main_exon 5UTR chr14 20,242,792 20,242,822 +
CDS chr14 20,242,822 20,243,763 +
3UTR chr14 20,243,763 20,243,766 +