Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1C1 Olfactory Receptor

Gene Symbol OR1C11 (View this gene in GeneCards)
Family 1
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.01 (functional)
Aliases HSTPCR27, OR1-42, HsOR1.5.10, ORL3029, ORL211
External Ids HGNC: 8182   GeneBank: AB065625, AF399560, BK004365, HSTPCR27P, NM_012353   ORDB: ORL3029, ORL211   
Build #39 labels OR1C1
Chromosomal location 1:247,757,465-247,758,406 (-)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1F1 60% 305
OR1F12 55.41% 305
OR1J4 53.35% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1AB2 59% 313
Chimp CONTIG904.61-2336 60% 310
Mouse Or1ab2 57% 310
Rat Or1f33 59% 309
Cow OR1AB2 58% 309

Expression evidences

Source Accession
mRNA AB529299
GNF Atlas2 gnf1h03759_at

Sequence information

Nucleotide sequence ATGGAAAAAAGAAATCTAACAGTTGTCAGGGAATTCGTCCTTCTGGGACTTCCTAGCTCA
GCAGAGCAGCAGCACCTCCTGTCTGTGCTCTTTCTCTGTATGTATTTAGCCACCACCTTG
GGGAACATGCTCATCATTGCGACGATTGGCTTTGACTCTCACCTCCATTCCCCTATGTAC
TTCTTCCTTAGTAACTTGGCCTTTGTTGACATCTGCTTTACGTCGACTACAGTCCCCCAA
ATGGTAGTGAATATCTTGACTGGCACCAAGACTATCTCTTTTGCAGGCTGCCTCACCCAG
CTCTTCTTCTTCGTTTCTTTTGTGAATATGGACAGCCTCCTTCTGTGTGTGATGGCGTAT
GATAGATATGTGGCGATTTGCCACCCCTTACATTACACCGCCAGAATGAACCTGTGCCTT
TGTGTCCAGCTAGTGGCTGGACTGTGGCTTGTTACTTACCTCCACGCCCTCCTGCATACT
GTCCTAATAGCACAGCTGTCCTTCTGTGCCTCCAATATCATCCATCATTTCTTCTGTGAT
CTCAATCCTCTCCTGCAGCTCTCTTGCTCTGACGTCTCCTTCAATGTAATGATCATTTTT
GCAGTAGGAGGTCTATTGGCTCTCACGCCCCTTGTCTGTATCCTCGTATCTTATGGACTT
ATCTTCTCCACTGTTCTGAAGATCACCTCTACTCAGGGCAAGCAGAGAGCTGTTTCCACC
TGCAGCTGCCACCTGTCAGTGGTGGTGTTGTTTTACGGCACAGCCATCGCCGTCTATTTC
AGCCCTTCATCCCCCCATATGCCTGAGAGCGACACTCTGTCAACCATCATGTATTCAATG
GTGGCTCCGATGCTGAATCCTTTCATCTATACCCTAAGGAACAGGGATATGAAGAGGGGA
CTTCAGAAAATGCTTCTCAAGTGCACAGTCTTTCAGCAGCAA
Conceptual translation MEKRNLTVVREFVLLGLPSSAEQQHLLSVLFLCMYLATTLGNMLIIATIGFDSHLHSPMY
FFLSNLAFVDICFTSTTVPQMVVNILTGTKTISFAGCLTQLFFFVSFVNMDSLLLCVMAY
DRYVAICHPLHYTARMNLCLCVQLVAGLWLVTYLHALLHTVLIAQLSFCASNIIHHFFCD
LNPLLQLSCSDVSFNVMIIFAVGGLLALTPLVCILVSYGLIFSTVLKITSTQGKQRAVST
CSCHLSVVVLFYGTAIAVYFSPSSPHMPESDTLSTIMYSMVAPMLNPFIYTLRNRDMKRG
LQKMLLKCTVFQQQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 247,921,083 247,921,083 NS A/G M/T rs12068080 (DbSNP)
1 247,921,238 247,921,238 SYN A/G L/L rs41304161 (DbSNP)
1 247,921,412 247,921,412 SYN C/G T/T rs41304163 (DbSNP)
1 247,921,352 247,921,352 SYN C/T A/A rs1552813 (DbSNP)
1 247,921,100 247,921,100 SYN G/T G/G rs1552812 (DbSNP)
1 247,758,050 247,758,050 SYN C/T A/A 1000GP (CEU, CHBJPT)
1 247,757,798 247,757,798 SYN T/G G/G 1000GP (CEU, CHBJPT)
1 247,758,110 247,758,110 SYN G/C T/T 1000GP (CEU)
1 247,757,956 247,757,956 NS C/A V/F 1000GP (CHBJPT)
1 247,757,966 247,757,966 SYN T/C G/G 1000GP (CHBJPT)
1 100 -100 NS G/A T/M 1000GP (YRI, YRI, YRI)
1 100 -100 SYN T/G G/G 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T209M C179R A67V % Freq CORP
1 T C A 97.00 0.019
2 T C V 1.61 0.001
3 M C A 0.77 0.019
4 T R A 0.61 0.076

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1C1.aApr07-unspliced main_exon 3UTR chr1 247,757,462 247,757,465 -
CDS chr1 247,757,465 247,758,406 -