Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1D2 Olfactory Receptor

Gene Symbol OR1D21 (View this gene in GeneCards)
Family 1
Subfamily D
Pseudogene No
CORP pseudogene probability score
Aliases OR17-4, OR17-6, HsOR17.1.2, ORL521, ORL19
External Ids HGNC: 8183   GeneBank: AF087917, AF399535, BC069552, BK004244, HSU04678, NM_002548   ORDB: ORL521, ORL19   
Build #39 labels OR1D2
Chromosomal location 17:3,092,061-3,092,996 (-)
Cluster 17@3b
Synteny CLIC#39
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1D3P 84.98% 313
OR1D4 82.26% 310
OR1D5 82.58% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1D3P 77% 119
Chimp CONTIG3463.6-1888 98% 312
Mouse Or1d2 79% 119
Rat Or1d2 80% 119
Cow OR1D3 86% 310

Expression evidences

Source Accession
ESTs CO247635
mRNA AB529300
GNF Atlas2 221464_at

Sequence information

Nucleotide sequence ATGGATGGAGGCAACCAGAGTGAAGGTTCAGAGTTCCTTCTCCTGGGGATGTCAGAGAGT
CCTGAGCAGCAGCGGATCCTGTTTTGGATGTTCCTGTCCATGTACCTGGTCACGGTGGTG
GGAAATGTGCTCATCATCCTGGCCATCAGCTCTGATTCCCGCCTGCACACCCCCGTGTAC
TTCTTCCTGGCCAACCTCTCCTTCACTGACCTCTTCTTTGTCACCAACACAATCCCCAAG
ATGCTGGTGAACCTCCAGTCCCATAACAAAGCCATCTCCTATGCAGGGTGTCTGACACAG
CTCTACTTCCTGGTCTCCTTGGTGGCCCTGGACAACCTCATCCTGGCTGTGATGGCATAT
GACCGCTATGTGGCCATCTGCTGCCCCCTCCACTACACCACAGCCATGAGCCCTAAGCTC
TGTATCTTACTCCTTTCCTTGTGTTGGGTCCTATCCGTCCTCTATGGCCTCATACACACC
CTCCTCATGACCAGAGTGACCTTCTGTGGGTCACGAAAAATCCACTACATCTTCTGTGAG
ATGTATGTATTGCTGAGGATGGCATGTTCCAACATTCAGATTAATCACACAGTGCTGATT
GCCACAGGCTGCTTCATCTTCCTCATTCCCTTTGGATTCGTGATCATTTCCTATGTGCTG
ATTATCAGAGCCATCCTCAGAATACCCTCAGTCTCTAAGAAATACAAAGCCTTCTCCACC
TGTGCCTCCCATTTGGGTGCAGTCTCCCTCTTCTATGGGACACTTTGTATGGTATACCTA
AAGCCCCTCCATACCTACTCTGTGAAGGACTCAGTAGCCACAGTGATGTATGCTGTGGTG
ACACCCATGATGAATCCCTTCATCTACAGCCTGAGGAACAAGGACATGCATGGGGCTCTG
GGAAGACTCCTAGATAAACACTTTAAGAGGCTGACA
Conceptual translation MDGGNQSEGSEFLLLGMSESPEQQRILFWMFLSMYLVTVVGNVLIILAISSDSRLHTPVY
FFLANLSFTDLFFVTNTIPKMLVNLQSHNKAISYAGCLTQLYFLVSLVALDNLILAVMAY
DRYVAICCPLHYTTAMSPKLCILLLSLCWVLSVLYGLIHTLLMTRVTFCGSRKIHYIFCE
MYVLLRMACSNIQINHTVLIATGCFIFLIPFGFVIISYVLIIRAILRIPSVSKKYKAFST
CASHLGAVSLFYGTLCMVYLKPLHTYSVKDSVATVMYAVVTPMMNPFIYSLRNKDMHGAL
GRLLDKHFKRLT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
17 2,995,927 2,995,927 NS A/G C/R rs73300984 (DbSNP)
17 2,995,572 2,995,572 NS A/G I/T rs4300683 (DbSNP)
17 2,996,199 2,996,199 NS A/T F/Y rs9916628 (DbSNP)
17 2,995,707 2,995,707 NS A/T I/N rs61736111 (DbSNP)
17 2,995,658 2,995,658 NS A/T F/L rs61736110 (DbSNP)
17 2,995,662 2,995,662 NS C/G R/P rs61736104 (DbSNP)
17 2,995,651 2,995,651 NS C/T V/M rs55803944 (DbSNP)
17 2,995,716 2,995,716 NS G/A T/I rs61736112 (DbSNP)
17 2,995,698 2,995,698 NS G/A A/V rs61736106 (DbSNP)
17 2,995,876 2,995,876 NS T/C K/E rs61736107 (DbSNP)
17 2,996,217 2,996,217 NS T/C Q/R rs769423 (DbSNP)
17 2,995,994 2,995,994 SYN T/C T/T rs769424 (DbSNP)
17 3,092,302 3,092,302 NS G/A S/F 1000GP (CEU)
17 3,092,278 3,092,278 NS G/A T/I 1000GP (CEU)
17 100 -100 NS G/A T/I 1000GP (YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 114 (Hasin)
17 2,993,355 2,996,390 CopyNumber #96 (Waszak)
17 2,995,650 2,995,872 Del(-15) #26(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I288V T240I S232F V214M P210R H175Y R122C F31Y R25Q % Freq CORP
1 I T S V P H R F R 73.12 0.478
2 I I S V P H R F R 13.67 0.772
3 I T S V P H R F Q 8.53 0.478
4 I T S V P H R Y R 1.54 0.512
5 I I S M P H R F R 1.38 0.772
6 I I S V R H R F R 1.15 0.600
7 I T S V P Y R F R 0.23 0.478
8 V I S V P H R F R 0.15 0.772
9 I I F M P H R F R 0.08 0.772
10 I T F V P H R F R 0.08 0.478
11 V I S V P H C F R 0.08 0.984

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1D2.aApr07-unspliced main_exon 3UTR chr17 3,092,058 3,092,061 -
CDS chr17 3,092,061 3,092,996 -
5UTR chr17 3,092,996 3,093,004 -