Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2AT4 Olfactory Receptor

Gene Symbol OR2AT41 (View this gene in GeneCards)
Family 2
Subfamily AT
Pseudogene No
CORP pseudogene probability score 0.1 (functional)
Aliases OR11-265, HsOR11.16.2
External Ids HGNC: 19620   GeneBank: BK004820, NM_001005285   
Build #39 labels OR2AT4
Chromosomal location 11:75,088,754-75,089,713 (-)
Cluster 11@75
Synteny CLIC#28
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2AT1P 83.4% 253
OR2AT2P 82.52% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2AT2B 92% 309
Chimp CONTIG387.148-1144 99% 320
Mouse Or2at1 84% 315
Mouse Or2at4 88% 310
Rat Or2at1 84% 315
Cow OR2AT2B 90% 309
Cow OR2AT2CP 85% 272

Expression evidences

Source Accession
mRNA BC136959
GNF Atlas2 gnf1h02275_at

Sequence information

Nucleotide sequence ATGGATGCCACAGCCTGTAATGAATCAGTGGATGGCTCACCCGTCTTCTATCTATTGGGC
ATCCCCTCTCTGCCAGAGACCTTCTTCCTCCCTGTGTTTTTTATTTTCCTCCTCTTCTAC
CTTCTCATCCTGATGGGTAATGCCCTGATCCTGGTGGCCGTGGTGGCAGAGCCCAGCCTC
CACAAGCCCATGTACTTCTTTCTGATCAATCTCTCCACCTTGGACATCCTTTTCACCACA
ACCACTGTCCCCAAGATGCTGTCCTTATTCTTGCTTGGGGACCGCTTCCTCAGCTTTTCT
TCCTGCTTACTGCAGATGTACCTCTTCCAAAGTTTTACATGTTCAGAAGCCTTCATCCTG
GTGGTCATGGCCTATGACCGCTATGTGGCTATCTGCCACCCACTGCACTACCCTGTCCTC
ATGAACCCACAGACCAATGCTACCTTGGCAGCCAGTGCCTGGCTAACTGCCCTCCTCCTG
CCCATCCCAGCAGTAGTAAGGACCTCCCAGATGGCATATAACAGCATTGCCTACATCTAC
CACTGCTTCTGTGATCATCTGGCTGTGGTCCAGGCCTCCTGCTCTGACACCACCCCCCAG
ACCCTCATGGGCTTCTGCATCGCCATGGTGGTGTCCTTCCTCCCCCTTCTCCTGGTGCTT
CTCTCCTATGTCCACATCCTGGCCTCAGTGCTTCGCATCAGTTCCCTAGAAGGACGGGCA
AAAGCCTTCTCCACCTGCAGCTCCCACCTTCTGGTCGTGGGCACCTACTACTCATCTATT
GCCATAGCCTACGTGGCCTACAGGGCTGACCTGCCCCTTGACTTCCATATCATGGGCAAT
GTGGTATATGCCATTCTCACACCAATTCTCAACCCCCTCATTTACACGCTGAGAAACAGG
GATGTAAAGGCAGCCATCACCAAAATCATGTCTCAAGACCCAGGCTGTGACAGGAGCATT
Conceptual translation MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALILVAVVAEPSL
HKPMYFFLINLSTLDILFTTTTVPKMLSLFLLGDRFLSFSSCLLQMYLFQSFTCSEAFIL
VVMAYDRYVAICHPLHYPVLMNPQTNATLAASAWLTALLLPIPAVVRTSQMAYNSIAYIY
HCFCDHLAVVQASCSDTTPQTLMGFCIAMVVSFLPLLLVLLSYVHILASVLRISSLEGRA
KAFSTCSSHLLVVGTYYSSIAIAYVAYRADLPLDFHIMGNVVYAILTPILNPLIYTLRNR
DVKAAITKIMSQDPGCDRSI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 74,800,027 74,800,027 SYN A/G S/S rs61897539 (DbSNP)
11 74,800,600 74,800,600 SYN A/G A/A rs11236324 (DbSNP)
11 75,089,093 75,089,093 SYN G/A I/I 1000GP (CEU)
11 100 -100 NS G/C A/G 1000GP (YRI)
11 100 -100 SYN T/C S/S 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 212 (Hasin)
11 74,797,799 74,800,858 Deletion #227 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A242G V15I % Freq CORP
1 A V 98.14 0.184
2 G V 1.20 0.392
3 A I 0.66 0.184

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2AT4.aApr07-unspliced main_exon 3UTR chr11 75,088,751 75,088,754 -
CDS chr11 75,088,754 75,089,713 -