Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2B11 Olfactory Receptor

Gene Symbol OR2B111 (View this gene in GeneCards)
Family 2
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.28 (functional)
Aliases HsOR1.5.1
External Ids HGNC: 31249   GeneBank: NM_001004492   
Build #39 labels
Chromosomal location 1:247,451,032-247,451,982 (-)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2B2 58.53% 299
OR2B3 59.27% 302
OR2B4P 61.36% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2B11 85% 316
Chimp CONTIG*********** 99% 317
Mouse Or2b11 87% 317
Rat Or2b11 84% 317
Cow OR2B11 89% 316

Expression evidences

Source Accession
ESTs BF838729
mRNA BC137205
GNF Atlas2 gnf1h09716_at

Sequence information

Nucleotide sequence ATGAAAAGTGACAACCATAGCTTCTTAGGGGACTCCCCTAAAGCCTTCATCCTTCTGGGT
GTGTCTGACAGGCCGTGGCTGGAACTCCCTCTCTTTGTGGTCCTCCTGCTGTCCTATGTG
CTGGCCATGTTGGGGAACGTCGCCATCATCCTGGCATCCCGGGTGGATCCTCAACTCCAC
AGCCCCATGTACATCTTCCTCAGTCACCTGTCCTTCCTGGACCTCTGCTACACCACCACG
ACAGTCCCTCAGATGCTGGTCAACATGGGCAGTTCCCAGAAGACCATCAGCTATGGAGGC
TGCACTGTGCAATATGCAGTCTTCCACTGGCTGGGATGCACGGAGTGCATCGTCCTGGCC
GCCATGGCCCTGGACCGCTACGTGGCCATCTGCAAGCCCCTGCACTATGCCGTTCTCATG
CACCGTGCTCTCTGTCAGCAGCTCGTGGCTCTGGCCTGGCTCAGTGGCTTCGGCAACTCC
TTCGTGCAGGTGGTCCTGACGGTGCAATTGCCATTCTGCGGGCGGCAGGTGCTGAACAAC
TTTTTCTGTGAGGTGCCGGCCGTGATCAAGCTGTCGTGTGCTGACACCGCTGTGAATGAC
ACCATACTGGCTGTGCTGGTGGCCTTCTTCGTGTTGGTGCCCCTGGCTCTCATCCTTCTC
TCCTATGGCTTTATTGCCCGGGCAGTGCTCAGGATCCAGTCCTCCAAGGGACGACACAAG
GCCTTTGGGACGTGTTCCTCCCACCTGATGATCGTCTCCCTCTTCTACCTACCTGCGATT
TACATGTATCTGCAGCCCCCTTCCAGCTACTCCCAAGAGCAGGGCAAATTTATTTCTCTC
TTCTATTCCATAATCACCCCCACTCTCAATCCCTTCACCTACACCCTGAGAAATAAAGAT
ATGAAGGGGGCTCTGAGGAGACTTCTGGCCAGGATCTGGAGGCTCTGTGGA
Conceptual translation MKSDNHSFLGDSPKAFILLGVSDRPWLELPLFVVLLLSYVLAMLGNVAIILASRVDPQLH
SPMYIFLSHLSFLDLCYTTTTVPQMLVNMGSSQKTISYGGCTVQYAVFHWLGCTECIVLA
AMALDRYVAICKPLHYAVLMHRALCQQLVALAWLSGFGNSFVQVVLTVQLPFCGRQVLNN
FFCEVPAVIKLSCADTAVNDTILAVLVAFFVLVPLALILLSYGFIARAVLRIQSSKGRHK
AFGTCSSHLMIVSLFYLPAIYMYLQPPSSYSQEQGKFISLFYSIITPTLNPFTYTLRNKD
MKGALRRLLARIWRLCG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS T/C D/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN C/T T/T 1000GP (YRI, YRI, YRI, YRI)
1 247,451,084 247,451,084 NS T/C D/G 1000GP (CEU)
1 247,451,105 247,451,105 NS G/A T/I 1000GP (CEU)
1 247,451,251 247,451,251 SYN C/T T/T 1000GP (CEU)
1 247,451,315 247,451,315 NS C/T G/D 1000GP (CEU, CHBJPT)
1 247,451,367 247,451,367 NS G/C L/V 1000GP (CHBJPT)
1 247,451,369 247,451,369 NS A/C V/G 1000GP (CHBJPT)
1 247,451,391 247,451,391 NS C/T V/M 1000GP (CEU, CHBJPT)
1 247,451,448 247,451,448 NS T/C N/D 1000GP (CHBJPT)
1 247,451,594 247,451,594 NS A/C I/S 1000GP (CEU, CHBJPT)
1 247,451,950 247,451,950 SYN G/A D/D 1000GP (CEU, CHBJPT)
1 247,614,386 247,614,386 NS C/T G/D rs12070953 (DbSNP)
1 247,614,407 247,614,407 NS A/G I/T rs12065526 (DbSNP)
1 247,614,553 247,614,553 SYN C/T T/T rs12086048 (DbSNP)
1 247,614,617 247,614,617 NS C/T G/D rs4925663 (DbSNP)
1 247,614,657 247,614,657 NS A/G F/L rs73140586 (DbSNP)
1 247,614,693 247,614,693 NS C/T V/M rs6695302 (DbSNP)
1 247,614,763 247,614,763 SYN C/T G/G rs58058243 (DbSNP)
1 247,614,784 247,614,784 SYN C/G T/T rs74154654 (DbSNP)
1 247,614,896 247,614,896 NS A/C I/S rs11583410 (DbSNP)
1 247,614,925 247,614,925 SYN A/G A/A rs73140588 (DbSNP)
1 247,615,154 247,615,153 Ins(1) -/C rs35822304 (DbSNP)
1 247,615,252 247,615,252 SYN A/G D/D rs12028142 (DbSNP)
1 247,615,263 247,615,263 Del(1) -/A rs35305980 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

D300G T293I N290H R231M R227W G223D F210L D200E V198M N179D I130S N46S S12Y % Freq CORP
1 D T N R R D F D M N I N S 32.26 0.209
2 D T N R R G F D M N S N S 29.26 0.720
3 D T N R R G F D M N I N S 13.90 0.209
4 G I N R R G F D M N I N S 7.60 0.209
5 D T N R R D F D M N S N S 4.99 0.720
6 D T N R R G L D V N I N S 4.15 0.209
7 G I N R R G L D V N I N S 1.46 0.209
8 G I N R W G L D V N I N S 0.77 0.209
9 G I N R R G F D V N I N S 0.61 0.209
10 D T N R R G L D V N S N S 0.61 0.720
11 D T N R R D F D V N I N S 0.61 0.209
12 D T N R R G F D V N I N S 0.54 0.209
13 D T N R R G F D M N S S S 0.38 1.000
14 D T N R R D F D M D I N S 0.38 0.209
15 G I N R R G L E V N I N S 0.31 0.209
16 D I N R R G F D M N I N S 0.23 0.209
17 G I N R R G F D M N S N S 0.23 0.720
18 D T N R R G F D M N S N Y 0.15 0.720
19 D T H R R D F D M N I N S 0.15 0.119
20 D T N R W G F D M N S N S 0.15 0.720
21 D T N R R G F D V N S N S 0.15 0.720
22 D T N R R D F D V N S N S 0.15 0.720
23 D T N R R G F D M N I S S 0.15 1.000
24 D T N R R G L D V N I S S 0.15 1.000
25 D T N R R D F D M D S N S 0.08 0.720
26 D I N R R D F D M N I N S 0.08 0.209
27 D T N R R G F D V N S S S 0.08 1.000
28 D I N R R G F D M N S N S 0.08 0.720
29 D T N R R G L D M N I N S 0.08 0.209
30 D T N R R G F D M N I N Y 0.08 0.209
31 G I N R R D F D M N I N S 0.08 0.209
32 D T N M R G F D M N I N S 0.08 0.209

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2B11.aApr07-unspliced main_exon 3UTR chr1 247,451,029 247,451,032 -
CDS chr1 247,451,032 247,451,982 -