Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2K2 Olfactory Receptor

Gene Symbol OR2K21 (View this gene in GeneCards)
Family 2
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.12 (functional)
Aliases HSHTPCRH06, OR9-17, HsOR9.5.1, ORL3221
External Ids HGNC: 8264   GeneBank: AB065707, BK004277, HSHTPRH06, NM_205859   ORDB: ORL3221   
Build #39 labels OR2K2, OR2AR1P
Chromosomal location 9:111,327,486-111,328,433 (-)
Cluster 9@114
Synteny CLIC#20
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR13D1 62.21% 307
OR13D2P 61.15% 296
OR13F1 65.12% 301

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2K2 86% 316
Chimp CONTIG63.195-2439 98% 316
Mouse Or2k2 88% 309
Rat Or2k2 87% 309
Cow OR2K2 86% 316

Expression evidences

Source Accession
ESTs DT932712
mRNA X64977
GNF Atlas2 gnf1h05181_at
GNF Atlas2 gnf1h11034_s_at

Sequence information

Nucleotide sequence ATGCAAGGAGAAAACTTCACCATTTGGAGCATTTTTTTCTTGGAGGGATTTTCCCAGTAC
CCAGGGTTAGAAGTGGTTCTCTTCGTCTTCAGCCTTGTAATGTATCTGACAACGCTCTTG
GGCAACAGCACTCTTATTTTGATCACTATCCTAGATTCACGCCTTAAAACCCCCATGTAC
TTATTCCTTGGAAATCTCTCTTTCATGGATATTTGTTACACATCTGCCTCTGTTCCTACT
TTGCTGGTGAACTTGCTGTCATCCCAGAAAACCATTATCTTTTCTGGGTGTGCTGTACAG
ATGTATCTGTCCCTTGCCATGGGCTCCACAGAGTGTGTGCTCCTGGCCGTGATGGCATAT
GACCGTTATGTGGCCATTTGTAACCCGCTGAGATACTCCATCATCATGAACAGGTGCGTC
TGTGCACGGATGGCTACGGTCTCCTGGGTGACGGGTTGCCTGACCGCTCTGCTGGAAACC
AGTTTTGCCCTGCAGATACCCCTCTGTGGGAATCTCATCGATCACTTCACGTGTGAAATT
CTGGCGGTGCTAAAGTTAGCTTGCACAAGTTCACTGCTCATGAACACCATCATGCTGGTG
GTCAGCATTCTCCTCTTGCCAATTCCAATGCTCTTAGTTTGCATCTCTTACATCTTCATC
CTTTCCACTATTCTGAGAATCACCTCAGCAGAGGGAAGAAACAAGGCTTTTTCTACCTGT
GGTGCCCATTTGACTGTGGTGATTTTGTATTATGGGGCTGCCCTCTCTATGTACCTAAAG
CCTTCTTCATCAAATGCACAAAAAATAGACAAAATCATCTCGTTGCTTTACGGAGTGCTT
ACCCCTATGTTGAACCCCATAATTTACAGTTTAAGAAACAAGGAAGTCAAAGATGCTATG
AAGAAATTGCTGGGCAAAATAACATTGCATCAAACACACGAACATCTC
Conceptual translation MQGENFTIWSIFFLEGFSQYPGLEVVLFVFSLVMYLTTLLGNSTLILITILDSRLKTPMY
LFLGNLSFMDICYTSASVPTLLVNLLSSQKTIIFSGCAVQMYLSLAMGSTECVLLAVMAY
DRYVAICNPLRYSIIMNRCVCARMATVSWVTGCLTALLETSFALQIPLCGNLIDHFTCEI
LAVLKLACTSSLLMNTIMLVVSILLLPIPMLLVCISYIFILSTILRITSAEGRNKAFSTC
GAHLTVVILYYGAALSMYLKPSSSNAQKIDKIISLLYGVLTPMLNPIIYSLRNKEVKDAM
KKLLGKITLHQTHEHL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS G/A T/M 1000GP (YRI, YRI)
9 100 -100 SYN G/A Y/Y 1000GP (YRI, YRI)
9 111,327,602 111,327,602 NS C/T G/R 1000GP (CEU, CHBJPT)
9 111,327,999 111,327,999 SYN A/G A/A 1000GP (CEU, CHBJPT)
9 111,328,274 111,328,274 NS G/A R/C 1000GP (CEU)
9 114,089,882 114,089,882 NS T/C R/G rs61748723 (DbSNP)
9 114,089,883 114,089,883 SYN G/A Y/Y rs61748722 (DbSNP)
9 114,089,896 114,089,896 NS A/T I/N rs13284539 (DbSNP)
9 114,089,897 114,089,897 NS A/T F/I rs13285778 (DbSNP)
9 114,090,277 114,090,277 NS A/G M/T rs73656223 (DbSNP)
9 114,090,279 114,090,279 SYN G/A A/A rs314452 (DbSNP)
9 114,090,401 114,090,401 NS A/G F/L rs72763200 (DbSNP)
9 114,090,629 114,090,629 NS C/T V/I rs73531578 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 162 (Hasin)
9 114,089,731 114,089,962 Del(-22) #5(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G278R T177M T146M L55I R54C V29I % Freq CORP
1 G T T L R V 88.79 0.281
2 R T T L R V 9.06 0.281
3 G T M L R V 1.08 0.281
4 G T T L R I 0.77 0.281
5 G T T L C V 0.15 0.281
6 G T T I R V 0.08 0.675
7 G M T L R V 0.08 0.281

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
KIAA0368andOR2K2.cApr07 main_exon 3UTR chr9 111,327,483 111,327,486 -
CDS chr9 111,327,486 111,328,433 -
5UTR chr9 111,328,433 111,328,482 -
exon_5UTR chr9 111,330,106 111,330,224 -
exon_5UTR chr9 111,363,588 111,363,659 -
exon_5UTR chr9 111,366,239 111,366,286 -