Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2L8 Olfactory Receptor

Gene Symbol OR2L81 (View this gene in GeneCards)
Family 2
Subfamily L
Pseudogene No
CORP pseudogene probability score
Aliases OR1-46, HsOR1.5.18, ORL3015, ORL3017
External Ids HGNC: 15014   GeneBank: AB065627, BK004459, NM_001001963   ORDB: ORL3015, ORL3017   
Build #39 labels OR2L8
Chromosomal location 1:247,948,858-247,949,793 (+)
Cluster 1@248
Synteny CLIC#5
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs4925583)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2L3 95.51% 312
OR2L6P 92.63% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2L5 82% 312
Dog OR2L3B 82% 312
Dog OR2L5C 82% 312
Dog OR2L3 82% 312
Chimp CONTIG*********** 97% 312
Chimp CONTIG658.2-1937 97% 312
Mouse Or2l5 79% 312
Rat Or2l5b 79% 312
Cow OR2L3 85% 312
Cow OR2L3C 82% 312

Expression evidences

Source Accession
mRNA BC140751

Sequence information

Nucleotide sequence ATGGAAAATTACAATCAAACATCAACTGATTTCATCTTATTGGGGCTGTTTCCACCATCA
AGAATTGACCTTTTCTTCTTCATTCTCATTGTTTTCATTTTCCTGATGGCTCTAATTGGA
AACCTGTCCATGATTCTTCTCATCTTCTTGGACACCCATCTCCACACACCCATGTATTTC
CTACTGAGTCAGCTCTCCCTCATTGACCTAAATTACATCTCCACCATTGTTCCTAAGATG
GCATCTGATTTTCTGCATGGAAACAAGTCTATCTCCTTCACTGGGTGTGGGATTCAGAGT
TTCTTCTTCTTGGCATTAGGAGGTGCAGAAGCACTACTTTTGGCATCTATGGCCTATGAT
CGTTACATTGCTATTTGCTTTCCTCTCCACTATCTCATCCGCATGAGCAAAAGAGTGTGT
GTGCTGATGATAACAGGGTCTTGGATCATAGGCTCGATCAATGCTTGTGCTCACACTGTA
TATGTACTCCATATTCCTTATTGCCGATCCAGGGCCATCAATCATTTCTTCTGTGATGTC
CCAGCAATGGTGACTCTGGCCTGCATGGACACCTGGGTCTATGAGGGCACAGTGTTTTTG
AGTGCCACCATCTTTCTCGTGTTTCCCTTCATTGGTATTTCATGTTCCTATGGCCAGGTT
CTCTTTGCTGTCTACCACATGAAATCTGCAGAAGGGAGGAAGAAAGCCTATTTGACCTGC
AGCACCCACCTCACTGTAGTAACTTTCTACTATGCACCTTTTGTCTACACTTATCTACGT
CCAAGATCCCTGCGATCTCCAACAGAGGACAAGGTTCTGGCTGTCTTCTACACCATCCTC
ACCCCAATGCTCAACCCCATCATCTATAGCCTGAGGAACAAGGAGGTGATGGGGGCCCTG
ACACGAGTGAGTCAGAGAATCTGCTCTGTGAAAATG
Conceptual translation MENYNQTSTDFILLGLFPPSRIDLFFFILIVFIFLMALIGNLSMILLIFLDTHLHTPMYF
LLSQLSLIDLNYISTIVPKMASDFLHGNKSISFTGCGIQSFFFLALGGAEALLLASMAYD
RYIAICFPLHYLIRMSKRVCVLMITGSWIIGSINACAHTVYVLHIPYCRSRAINHFFCDV
PAMVTLACMDTWVYEGTVFLSATIFLVFPFIGISCSYGQVLFAVYHMKSAEGRKKAYLTC
STHLTVVTFYYAPFVYTYLRPRSLRSPTEDKVLAVFYTILTPMLNPIIYSLRNKEVMGAL
TRVSQRICSVKM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS T/G S/A 1000GP (YRI, YRI)
1 100 -100 SYN C/G S/S 1000GP (YRI, YRI)
1 247,949,507 247,949,507 NS A/G Y/C 1000GP (CEU, CHBJPT)
1 247,949,534 247,949,534 NS A/G H/R 1000GP (CEU, CHBJPT)
1 248,112,560 248,112,560 NS A/G H/R rs57818366 (DbSNP)
1 248,112,627 248,112,627 SYN C/T C/C rs4925787 (DbSNP)
1 248,112,738 248,112,738 SYN A/C V/V rs60155834 (DbSNP)
1 248,112,745 248,112,745 NS G/T G/C rs4925788 (DbSNP)
1 248,112,762 248,112,762 SYN C/T S/S rs4925789 (DbSNP)
1 248,112,762 248,112,763 mnp CA/TG rs34851853 (DbSNP)
1 248,112,763 248,112,763 NS A/G T/A rs4925790 (DbSNP)
1 248,112,771 248,112,771 SYN C/T I/I rs4925791 (DbSNP)
1 248,112,781 248,112,781 Del(1) -/T rs11284294 (DbSNP)
1 248,112,809 248,112,809 NS A/G Y/C rs4925583 (DbSNP)
1 248,112,836 248,112,836 NS A/G H/R rs4925792 (DbSNP)
1 248,112,915 248,112,915 SYN A/G A/A rs10888280 (DbSNP)
1 248,113,026 248,113,026 nonsense SNP A/T */Y rs10888281 (DbSNP)
1 248,113,040 248,113,040 NS A/G K/R rs10888282 (DbSNP)
1 248,113,061 248,113,061 NS A/C K/T rs74155337 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R134H G196C A202T S214A Y217C H226R C240S % Freq CORP
1 R C T S C R C 58.45 1.000
2 R G A S Y H C 20.28 0.030
3 R C A S C R C 9.22 1.000
4 R G A S C R C 4.30 1.000
5 R C A S Y H C 3.23 0.030
6 H C T S Y H C 1.00 0.030
7 R C A A Y R C 0.84 0.030
8 R G A A Y H C 0.61 0.030
9 R C A A Y H C 0.38 0.030
10 R C T A Y H C 0.31 0.030
11 R C A S Y R C 0.31 0.030
12 R C T S C H C 0.31 1.000
13 R G A S Y H S 0.15 0.088
14 R C A A C H C 0.08 1.000
15 R C T A Y R C 0.08 0.030
16 R G A A C R C 0.08 1.000
17 R G A A C H C 0.08 1.000
18 R C A A C R C 0.08 1.000
19 R G T S C R C 0.08 1.000
20 R C A S C H C 0.08 1.000
21 R G A A Y R C 0.08 0.030

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2L8.aApr07-unspliced main_exon CDS chr1 247,948,858 247,949,793 +
3UTR chr1 247,949,793 247,949,796 +