Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR2Y1 Olfactory Receptor

Gene Symbol OR2Y11 (View this gene in GeneCards)
Family 2
Subfamily Y
Pseudogene No
CORP pseudogene probability score 0.25 (functional)
Aliases OR5-2, HsOR5.4.2, ORL3131
External Ids HGNC: 14837   GeneBank: AB065676, AF399629, BK004351, NM_001001657   ORDB: ORL3131   
Build #39 labels OR2Y1
Chromosomal location 5:180,739,126-180,740,058 (-)
Cluster 5@180
Synteny CLIC#11
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2B7P 60.59% 307
OR2B8P 63.34% 311
OR2W6P 59.54% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR2G6 59% 308
Chimp CONTIG946.43-17537 99% 311
Mouse Or2y1 83% 309
Mouse Or2y1c 83% 309
Mouse Or2y1e 81% 310
Mouse Or2y1d 80% 309
Rat Or2y1c 83% 309
Rat Or2y1g 82% 311
Rat Or2y1h 82% 307
Rat Or2y1e 81% 310
Cow OR2Y1 80% 311

Expression evidences

Source Accession
mRNA BC140756

Sequence information

Nucleotide sequence ATGGGAAGTTTCAACACCAGTTTTGAAGATGGCTTCATTTTGGTGGGATTCTCAGATTGG
CCGCAACTGGAGCCCATCCTGTTTGTCTTTATTTTTATTTTCTACTCCCTAACTCTCTTT
GGCAACACCATCATCATCGCTCTCTCCTGGCTAGACCTTCGGCTGCACACACCTATGTAC
TTCTTTCTCTCTCATCTGTCCCTCCTGGACCTCTGCTTCACCACCAGCACCGTGCCCCAG
CTCCTGATCAACCTTTGCGGGGTGGACCGCACCATCACCCGTGGAGGGTGTGTGGCTCAG
CTCTTCATCTACCTAGCCCTGGGCTCCACAGAGTGTGTGCTCCTGGTGGTGATGGCCTTT
GACCGCTATGCTGCTGTCTGTCGTCCACTCCACTACATGGCCATCATGCACCCCCATCTC
TGCCAGACCCTGGCTATCGCCTCCTGGGGTGCGGGTTTCGTGAACTCTCTGATCCAGACA
GGTCTCGCAATGGCCATGCCTCTCTGTGGCCATCGACTGAATCACTTCTTCTGTGAGATG
CCTGTATTTCTGAAGTTGGCTTGTGCGGACACAGAAGGAACAGAGGCCAAGATGTTTGTG
GCCCGAGTCATAGTCGTGGCTGTTCCTGCAGCACTTATTCTAGGCTCCTATGTGCACATT
GCTCATGCAGTGCTGAGGGTGAAGTCAACGGCTGGGCGCAGAAAGGCTTTTGGGACTTGT
GGGTCCCACCTCCTAGTAGTTTTCCTTTTTTATGGCTCAGCCATCTACACATATCTCCAA
TCCATCCACAATTATTCTGAGCGTGAGGGAAAATTTGTTGCCCTTTTTTATACTATAATT
ACCCCCATTCTCAATCCTCTCATTTATACACTAAGAAACAAGGACGTGAAGGGGGCTCTG
TGGAAAGTACTATGGAGGGGCAGGGACTCAGGG
Conceptual translation MGSFNTSFEDGFILVGFSDWPQLEPILFVFIFIFYSLTLFGNTIIIALSWLDLRLHTPMY
FFLSHLSLLDLCFTTSTVPQLLINLCGVDRTITRGGCVAQLFIYLALGSTECVLLVVMAF
DRYAAVCRPLHYMAIMHPHLCQTLAIASWGAGFVNSLIQTGLAMAMPLCGHRLNHFFCEM
PVFLKLACADTEGTEAKMFVARVIVVAVPAALILGSYVHIAHAVLRVKSTAGRRKAFGTC
GSHLLVVFLFYGSAIYTYLQSIHNYSEREGKFVALFYTIITPILNPLIYTLRNKDVKGAL
WKVLWRGRDSG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
5 180,166,677 180,166,677 NS A/G C/R rs11960429 (DbSNP)
5 180,166,877 180,166,877 NS A/T F/Y rs73815111 (DbSNP)
5 180,166,461 180,166,461 NS C/G V/L rs10464105 (DbSNP)
5 180,166,599 180,166,599 NS C/T V/M rs11954074 (DbSNP)
5 180,166,362 180,166,362 NS G/A R/C rs61736842 (DbSNP)
5 180,166,866 180,166,866 NS G/A H/Y rs61737927 (DbSNP)
5 180,166,361 180,166,361 NS T/C H/R rs61736845 (DbSNP)
5 180,166,256 180,166,256 NS T/C H/R rs61735555 (DbSNP)
5 180,166,164 180,166,164 NS T/C T/A rs61737057 (DbSNP)
5 180,166,141 180,166,141 SYN C/T R/R rs9329115 (DbSNP)
5 180,166,834 180,166,834 SYN T/G T/T rs61737915 (DbSNP)
5 180,739,461 180,739,461 NS C/G V/L 1000GP (CEU)
5 180,739,599 180,739,599 NS C/T V/M 1000GP (CEU)
5 180,739,141 180,739,141 SYN C/T R/R 1000GP (CHBJPT)
5 100 -100 SYN C/T R/R 1000GP (YRI)
5 100 -100 NS C/T R/H 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
5 180,079,970 180,245,224 CopyNumber Variation_2612 (DGV)
5 180,087,198 180,281,476 CopyNumber Variation_3592 (DGV)
5 180,136,233 180,226,673 CopyNumber Variation_34493 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G307C R268H R233H R233C V154M R128C A106V H65Y F61Y R54W % Freq CORP
1 G R R R V R A H F R 92.55 0.454
2 G R H R V R A H F R 1.84 0.454
3 G R R R M C A H F R 1.31 0.454
4 G H R C V R A Y Y R 1.08 0.407
5 G H R C V R A H F R 0.61 0.407
6 G R R R V R A Y Y R 0.61 0.454
7 G R R R M R A H F R 0.31 0.454
8 G H R R V R A H F R 0.31 0.454
9 G R R R V R V H F R 0.31 0.454
10 G R R R V R A Y F W 0.23 0.454
11 C R R R V R A H F R 0.23 0.454
12 G R R C V R A H F R 0.23 0.407
13 G R H R V R A Y F R 0.23 0.454
14 G R R R V C A H F R 0.08 0.454
15 G R R R V R A Y F R 0.08 0.454

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR2Y1.aApr07-unspliced main_exon 3UTR chr5 180,739,123 180,739,126 -
CDS chr5 180,739,126 180,740,058 -