Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4F1P Olfactory Receptor

Gene Symbol OR4F1P1 (View this gene in GeneCards)
Family 4
Subfamily F
Pseudogene Yes
CORP pseudogene probability score
Aliases HSDJ0609N19, HsOR6.1.1P, ORL3151
External Ids HGNC: 8298   GeneBank: NG_004134, NG_004682   ORDB: ORL3151   
Build #39 labels OR4F1P
Chromosomal location 6:105,922-106,856 (-)
Cluster 6@0
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4F2P 99.04% 312
OR4F7P 99.35% 308
OR4F8P 98.4% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4F1 91% 312
Mouse Or4f7 82% 312
Rat Or4f7 83% 312
Rat Or4f7b 83% 312
Rat Or4f7c 82% 312
Cow OR4F1 90% 312
Cow OR4F1D 88% 312
Cow OR4F1C 88% 309
Orang OR4F58BP 72% 309
Horse OR4F1 91% 312
Chimp OR4F21 97% 312
Chimp OR4F1 96% 312
Chimp OR4F21BP 95% 310

Sequence information

Nucleotide sequence ATGGATGGAGAGAATCACTCAGTGGTATCTGAGTTTTTGTTTCTGGGACTCACTCATTCA
TGGGAGATCCAGCTCCTCCTCCTAGTGTTTTCCTCTGTGCTCTATGTGGCAAGCATTACT
GGAAACATCCTCATTGTATTTTCTGTGACCACTGACCCTCACTTACACTCCCCCATGTAC
TTTCTACTGGCCAGTCTCTCCTTCATTGACTTAGGAGCCTGCTCTGTCACTTCTCCCAAG
ATGATTTATGACCTGTTCAGAAAGCGCAAAGTCATCTCCTTTGGAGGCTGCATCGCTCAA
ATCTTCTTCATCCACGTCATTGGTGGTGTGGAGATGGTGCTGCTCATAGCCATGGCCTTT
GACAGTTATGTGGCCCTATTAAGCCCCTCCACTATCTGACCATTATGAGCCCAAGAATGT
GCCTTTCATTTCTGGCTGTTGCCTGGACCCTTGGTGTCAGTCACTCCCTGTTCCAACTGG
CATTTCTTGTTAATTTACCCTTCTGTGGCCCTAATGTGTTGGACAGCTTCTACTGTGACC
TTCCTCGGCTTCTCAGACTAGCCTGTACCGACACCTACAGATTGCAGTTCATGGTCACTG
TTAACAGTGGGTTTATCTGTGTGGGTACTTTCTTCATACTTGTAATCTCCTACATCTTCA
TCCTGTTTACTGTTTGGAAACATTCCTCAGGTGGTTCATCCAAGGCCCTTTCCACTCTTT
CAGCTCACAGCACAGCGGTCCTTTTGTTCTTTGGTCCACCCATGTTTGTGTATACATGGC
CACACCCTAATTCACAGATGGACAAGTTTCTGGCTATTTTTGATGCAGTTCTCACTCCTT
TTCTGAATCCAGTTGTCTATACATTCAGGAATAAGGAGATGAAGGCAGCAATAAAGAGAG
TATGCAAACAGCTAGTGATTTACAAGAAGATCTCA
Conceptual translation MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNILIVFSVTTDPHLHSPMY
FLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVIGGVEMVLLIAMAF
DSYVAL/KPLHYLTIMSPRMCLSFLAVAWTLGVSHSLFQLAFLVNLPFCGPNVLDSFYC
DLPRLLRLACTDTYRLQFMVTVNSGFICVGTFFILVISYIFILFTVWKHSSGGSSKALST
LSAHSTAVLLFFGPPMFVYTWPHPNSQMDKFLAIFDAVLTPFLNPVVYTFRNKEMKAAIK
RVCKQLVIYKKIS

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
6 60,001 775,274 CopyNumber Variation_3593 (DGV)
6 60,031 149,517 CopyNumber Variation_69282 (DGV)
6 76,709 118,238 CopyNumber Variation_32767 (DGV)
6 105,644 121,348 CopyNumber Variation_81178 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4F1P.aApr07-unspliced main_exon CDS_partial chr6 106,799 106,856 -
5UTR chr6 106,856 107,645 -