Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR4F4 Olfactory Receptor

Gene Symbol OR4F41 (View this gene in GeneCards)
Family 4
Subfamily F
Pseudogene No
CORP pseudogene probability score 0.14 (functional)
Aliases HS14a-1-A, OR19-3, HsOR15.2.6
External Ids HGNC: 8301   GeneBank: AF270636, AF399574, BK004223   
Build #39 labels OR4F4, OR4F18
Chromosomal location 15:101,922,145-101,923,059 (-)
Cluster 15@102
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR4F17 99.02% 305
OR4F5 98.69% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR4F26 78% 304
Chimp CONTIG1760.9-5104 98% 305
Mouse Or4f4-ps 84% 298
Mouse Or4f17-ps 83% 298
Mouse Or4f4b 82% 297
Rat Or4f4b-ps 82% 297
Cow OR4F4 85% 303

Expression evidences

Source Accession
mRNA AY972819

Sequence information

Nucleotide sequence ATGGTGACTGAATTCATTTTTCTGGGTCTCTCTGATTCTCAGGAACTCCAGACCTTCCTA
TTTATGTTGTTTTTTGTATTCTATGGAGGAATCGTGTTTGGAAACCTTCTTATTGTCATA
ACAGTGGTATCTGACTCCCACCTTCACTCTCCCATGTACTTCCTGCTAGCCAACCTCTCA
CTCATTGATCTGTCTCTGTCTTCAGTCACAGCCCCCAAGATGATTACTGACTTTTTCAGC
CAGCGCAAAGTCATCTCTTTCAAGGGCTGCCTTGTTCAGATATTTCTCCTTCACTTCTTT
GGTGGGAGTGAGATGGTGATCCTCATAGCCATGGGCTTTGACAGATATATAGCAATATGC
AAACCCCTACACTACACTACAATTATGTGTGGCAACGCATGTGTCGGCATTATGGCTGTC
GCATGGGGAATTGGCTTTCTCCATTCGGTGAGCCAGTTGGCCTTTGCCGTGCACTTACCC
TTCTGTGGTCCCAATGAGGTCGATAGTTTTTATTGTGACCTTCCTAGGGTAATCAAACTT
GCCTGTACAGATACCTACAGGCTAGATATTATGGTCATTGCTAACAGTGGTGTGCTCACT
GTGTGTTCTTTTGTTCTTCTAATCATCTCATACACTATCATCCTAATGACCATCCAGCAT
TGCCCTTTAGATAAGTCGTCCAAAGCTCTGTCCACTTTGACTGCTCACATTACAGTAGTT
CTTTTGTTCTTTGGACCATGTGTCTTTATTTATGCCTGGCCATTCCCCATCAAGTCATTA
GATAAATTCCTTGCTGTATTTTATTCTGTGATCACCCCTCTCTTGAACCCAATTATATAC
ACACTGAGGAACAAAGACATGAAGACGGCAATAAGACGGCTGAGAAAATGGGATGCACAT
TCTAGTGTAAAGTTT
Conceptual translation MVTEFIFLGLSDSQELQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLS
LIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAIC
KPLHYTTIMCGNACVGIMAVAWGIGFLHSVSQLAFAVHLPFCGPNEVDSFYCDLPRVIKL
ACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHCPLDKSSKALSTLTAHITVV
LLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRRLRKWDAH
SSVKF

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
15 102,391,933 102,520,985 CopyNumber Variation_72386 (DGV)
15 102,445,101 102,519,236 CopyNumber Variation_30727 (DGV)
15 102,446,317 102,520,985 CopyNumber Variation_72385 (DGV)
15 102,447,429 102,515,822 CopyNumber Variation_77144 (DGV)
15 102,454,764 102,508,554 CopyNumber Variation_77146 (DGV)
15 102,454,764 102,515,822 CopyNumber Variation_87921 (DGV)
15 102,459,407 102,519,236 CopyNumber Variation_32067 (DGV)
15 102,462,099 102,488,994 CopyNumber Variation_77147 (DGV)
15 102,462,099 102,491,577 CopyNumber Variation_87920 (DGV)
15 102,462,099 102,503,664 CopyNumber Variation_87922 (DGV)
15 102,463,086 102,463,292 Del(-14) #23(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR4F4.aApr07-unspliced main_exon 3UTR chr15 101,922,142 101,922,145 -
CDS chr15 101,922,145 101,923,059 -
5UTR chr15 101,923,059 101,923,116 -