Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52A4 Olfactory Receptor

Gene Symbol OR52A41 (View this gene in GeneCards)
Family 52
Subfamily A
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases HsOR11.3.49P
External Ids HGNC: 19579   GeneBank: NM_001005222   
Build #39 labels OR52A4
Chromosomal location 11:5,120,667-5,121,578 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52A1 69.58% 263
OR52A5 69.96% 263

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52A6 83% 263
Chimp CONTIG*********** 96% 293
Mouse Or52a20 70% 263
Rat Or52a20 70% 263
Cow OR52A1DP 71% 263

Expression evidences

Source Accession
mRNA DQ656009

Sequence information

Nucleotide sequence ATGGCCCTGCCTATTACAAATGGTACCTTGTTCATGCCTTTTGTGCTGACATTTATTGGG
ATCCCCGGTTTTGAATCTGTACAATGCTGGATTGGGATTCCATTCTGTGCTACGTATGTC
ATTGCTCTGATTGGAAATTCTCTACTTTTGATCATCATCAAATCTGAGCCAAGCCTCCAT
GAACCCATGTATATCTTCCTGGCCACGTTAGGAGCCACAGACATTTCACTTAGCACCAGC
ATTGTGCCCAAGATGCTTGATATTTTTTGGTTCCATTTGCCAGAGATATATTTTGATGCT
TGCCTCTTTCAGATGTGGCTCATCCACACATTTCAAGGCATTGAATCAGGAGTCCTGCTA
GCCATGGCTCTGGACCGCTGTGTAGCGATCTGTTATCCTCTGAGGCGTGCTATAGTATTC
ACTCGACAGCTAGTCACTTATATTGTAGTTGGAGTGACATTGCGGCCTGCCATTCTGGTA
ATTCCATGCCTATTGCTTATAAAATGCCATCTGAAACTCTACCGAACCAAGTTAATATAC
CACACTTACTGTGAACGCGTGGCCCTTGTGAAGCTTGCCACTGAAGATGTTTACATTAAT
AAGGTCTATGGTATCCTTGGAGCATTTATTGTTGGTGGGCTTGACTTCATTTTCATCACC
CTCTCCTATATTCAGATATTTATCACTGTCTTTCACTTGCCTCTGAAAGAGGCACGACTT
AAGGTATTTAATACATGTATTCCCCATATATATGTCTTCTTCCAATTCTATCTCCTTGCT
TTTTTTTTCATTTTTTACTCGCAGATTTGGATCTTATATCCCATCATATGTACATATCAC
CTTGTCCAGTCTTTACCTACTGGTCCCACCATTCCTCAACCCCTTTATCTATGGGTTAAA
GACCAAACACAT
Conceptual translation MALPITNGTLFMPFVLTFIGIPGFESVQCWIGIPFCATYVIALIGNSLLLIIIKSEPSLH
EPMYIFLATLGATDISLSTSIVPKMLDIFWFHLPEIYFDACLFQMWLIHTFQGIESGVLL
AMALDRCVAICYPLRRAIVFTRQLVTYIVVGVTLRPAILVIPCLLLIKCHLKLYRTKLIY
HTYCERVALVKLATEDVYINKVYGILGAFIVGGLDFIFITLSYIQIFITVFHLPLKEARL
KVFNTCIPHIYVFFQFYLLAFFFIFYSQIWILYPIICTYHLVQSLPTGPTIPQPLYLWVK
DQTH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,141,980 5,141,980 NS A/G C/R rs4426129 (DbSNP)
11 5,142,403 5,142,403 NS A/G C/R rs61880361 (DbSNP)
11 5,141,902 5,141,902 NS C/T A/T rs10837374 (DbSNP)
11 5,142,549 5,142,549 NS C/T G/D rs7947334 (DbSNP)
11 5,142,270 5,142,270 NS G/T S/Y rs10837375 (DbSNP)
11 5,142,671 5,142,671 SYN A/G N/N rs7944388 (DbSNP)
11 5,142,134 5,142,134 SYN C/T Q/Q rs11035760 (DbSNP)
11 5,120,672 5,120,672 NS T/C T/A 1000GP (CEU, CHBJPT)
11 5,121,319 5,121,319 NS T/C D/G 1000GP (CEU, CHBJPT)
11 5,121,441 5,121,441 SYN A/G N/N 1000GP (CEU, CHBJPT)
11 5,120,904 5,120,904 SYN C/T Q/Q 1000GP (CEU, CHBJPT)
11 5,120,750 5,120,750 NS A/G C/R 1000GP (CEU, CHBJPT)
11 5,121,040 5,121,040 NS T/G Y/S 1000GP (CEU, CHBJPT)
11 5,121,300 5,121,300 SYN C/T L/L 1000GP (CHBJPT)
11 100 -100 NS T/C T/A 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN C/T Q/Q 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,139,897 5,142,908 Deletion #198 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T303A C277R T220N Y180S D87G % Freq CORP
1 A R T S G 42.09 1.000
2 A R T S D 30.03 1.000
3 T C T Y D 25.50 1.000
4 A C T Y D 1.54 1.000
5 A R N S G 0.54 1.000
6 T R T Y D 0.15 1.000
7 T C T S D 0.08 1.000
8 A C T S G 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52A4.aApr07 main_exon 3UTR chr11 5,120,664 5,120,667 -
CDS chr11 5,120,667 5,121,578 -
5UTR chr11 5,121,578 5,121,907 -
exon_5UTR chr11 5,122,633 5,122,778 -
exon_5UTR chr11 5,123,443 5,123,511 -
exon_5UTR chr11 5,124,468 5,124,513 -
OR52A4.bApr07 main_exon CDS_partial chr11 5,121,155 5,121,578 -
5UTR chr11 5,121,578 5,121,907 -
exon_5UTR chr11 5,124,468 5,124,513 -