Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5AZ1P Olfactory Receptor

Gene Symbol OR5AZ1P1 (View this gene in GeneCards)
Family 5
Subfamily AZ
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-223, HsOR11.12.2P, ORL3617
External Ids HGNC: 15262   GeneBank: AB065549, AF399500, BK004802, NG_004207   ORDB: ORL3617   
Build #39 labels OR5AZ1P
Chromosomal location 11:57,917,302-57,918,230 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AR1 50.33% 300
OR5BA1P 50.33% 300
OR9H1P 49.02% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5AZ2 62% 291
Chimp CONTIG229.214-5050 93% 310
Mouse Or5p55 51% 300
Rat Or5p56 52% 300
Cow OR5AZ2 59% 303

Expression evidences

Source Accession
GNF Atlas2 gnf1h10859_at

Sequence information

Nucleotide sequence ATGGTGGAGAACCACACCCAAGTCACCTGGTTCCGCCTGCTGGGACTTACAGAGCAGGAG
GAGCTCAGAGGCATCCTCTTTGTGCTCTTCCTGCTCATGCATTCAGTCACTGTTATGGGC
AACCTGGGAATGATCACTCTGATCCATGCAGACCCACAGCTCCACACCCCCATGTATTTC
TTCCTGAGCGTCCTATCCTTGATAGACTCCTCGTTTTCCACAGTGGACATCCCCAGGCTG
CTGGAGAGCTTCCTCATCTCAAGCCAATCCATCTCCTTTGCAGGCTGTATGGTCCAGATG
GCCCTCATGATCCTCCATGGTACTGCTGAGTGTCTGCTCCTGGCCATCATGGCCTATGAC
CGATTCACCGCCATCTGCCACCCTCTCCTCTATCACACTATTATATCCCAATGTCTGTGT
GCCCTGCTGGTGGTGACCTGCTATACTGTTTCTGTTGCCAATTCAGCTTTGCTGACTGGG
TGCATCTTTAAGCTGCCCTACTGTGGCCCCAATGTCATTAACCACTATTTCTGTGACATC
CCCCCTGTGCTCCAACTTGCCGGTGCAGATACTACGAGGTTGAGACCATTATCTTCTCAT
TGTGTGCCTTGCTCATCCTCTTTACCATCACCATTATCCCAGTCTCCTATGCCTACATCC
TCGTGACCATTTGCAGGATGCGCTCCCTGCAAGCCCAGAGCAAAGCTCTCTCCACCTGTG
CCTCCCACCTCACCATCATCTGCCTCTTCTATAGCACCATCACCTTCATGTATGCTCAGC
CAAGCTCTCACAATTCCATGGAACACAACAAGGTCATGTCTGTCTTCTACACTGTGGTCA
TCCGCAGGCTGAACCCTCTGATCTACAGCCTGAGGAATAAAGATGTAAAATATGCTTTGA
AGAGGAGATGCCTGTGCAAGCTGTCTTCA
Conceptual translation MVENHTQVTWFRLLGLTEQEELRGILFVLFLLMHSVTVMGNLGMITLIHADPQLHTPMYF
FLSVLSLIDSSFSTVDIPRLLESFLISSQSISFAGCMVQMALMILHGTAECLLLAIMAYD
RFTAICHPLLYHTIISQCLCALLVVTCYTVSVANSALLTGCIFKLPYCGPNVINHYFCDI
PPVLQLAGAD/YEVETIIFSLCALLILFTITIIPVSYAYILVTICRMRSLQAQSKALST
CASHLTIICLFYSTITFMYAQPSSHNSMEHNKVMSVFYTVVIRRLNPLIYSLRNKDVKYA
LKRRCLCKLSS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 57,684,949 57,684,949 SNP A/C rs615133 (DbSNP)
11 57,685,334 57,685,334 SNP A/G rs616911 (DbSNP)
11 57,685,502 57,685,502 SNP C/G rs621683 (DbSNP)
11 57,685,196 57,685,196 SNP G/A rs633129 (DbSNP)
11 57,685,473 57,685,473 SNP G/A rs621731 (DbSNP)
11 57,917,477 57,917,477 SNP C/A 1000GP (CEU, CHBJPT)
11 57,917,724 57,917,724 SNP G/A 1000GP (CEU, CHBJPT)
11 57,917,862 57,917,862 SNP G/A 1000GP (CEU, CHBJPT)
11 57,918,001 57,918,001 SNP A/G 1000GP (CEU, CHBJPT)
11 57,917,885 57,917,885 SNP T/C 1000GP (CHBJPT)
11 57,918,150 57,918,150 SNP A/G 1000GP (CHBJPT)
11 100 -100 SNP C/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.