Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5B17 Olfactory Receptor

Gene Symbol OR5B171 (View this gene in GeneCards)
Family 5
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.64 (pseudogene)
Aliases OR11-237, HsOR11.12.17, ORL3415
External Ids HGNC: 15267   GeneBank: AB065849, BK004491, NM_001005489   ORDB: ORL3415   
Build #39 labels OR5B17, OR5B20P
Chromosomal location 11:58,358,128-58,359,069 (-)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5B1P 72.58% 310
OR5B2 71.1% 308
OR5B3 72.26% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5B2B 76% 309
Chimp CONTIG229.260-449 95% 309
Mouse Or5b3 71% 307
Rat Or5b95 71% 310
Cow OR5B140 74% 314

Expression evidences

Source Accession
GNF Atlas2 gnf1h10677_at

Sequence information

Nucleotide sequence ATGGAGAATAATACAGAGGTGAGTGAATTCATCCTGCTTGGTCTAACCAATGCCCCAGAA
CTACAGGTTCCCCTCTTTATCATGTTTACCCTCATCTACCTCATCACTCTGACTGGGAAC
CTGGGGATGATCATATTAATCCTGCTGGACTCTCATCTCCACACTCCCATGTACTTTTTT
CTCAGTAACCTGTCTCTTGCAGGCATTGGTTACTCCTCAGCTGTCACTCCAAAGGTTTTA
ACTGGGTTGCTTATAGAAGACAAAGCCATCTCCTACAGTGCCTGTGCTGCTCAGATGTTC
TTTTGTGCAGTCTTTGCCACTGTGGAAAATTACCTCTTGTCCTCAATGGCCTATGACCGC
TACGCAGCAGTGTGTAACCCCCTACATTATACCACCACCATGACAACACGTGTGTGTGCT
TGTCTGGCTATAGGCTGTTATGTCATTGGTTTTCTGAATGCTTCTATCCAAATTGGAGAT
ACATTTCGCCTCTCTTTCTGCATGTCCAATGTGATTCATCACTTTTTCTGTGACAAACCA
GCAGTCATTACTCTGACCTGCTCTGAGAAACACATTAGTGAGTTGATTCTTGTTCTTATA
TCAAGTTTTAATGTCTTTTTTGCACTTCTTGTTACCTTGATTTCCTATCTGTTCATATTG
ATCACCATTCTTAAGAGGCACACAGGTAAGGGATACCAGAAGCCTTTATCTACCTGTGGT
TCTCACCTCATTGCCATTTTCTTATTTTATATAACTGTCATCATCATGTACATACGACCA
AGTTCCAGTCATTCCATGGACACAGACAAAATTGCATCTGTGTTCTACACTATGATCATC
CCCATGCTCAGTCCTATAGTCTATACCCTGAGGAACAAAGACGTGAAGAATGCATTCATG
AAGGTTGTTGAGAAGGCAAAATATTCTCTAGATTCAGTCTTT
Conceptual translation MENNTEVSEFILLGLTNAPELQVPLFIMFTLIYLITLTGNLGMIILILLDSHLHTPMYFF
LSNLSLAGIGYSSAVTPKVLTGLLIEDKAISYSACAAQMFFCAVFATVENYLLSSMAYDR
YAAVCNPLHYTTTMTTRVCACLAIGCYVIGFLNASIQIGDTFRLSFCMSNVIHHFFCDKP
AVITLTCSEKHISELILVLISSFNVFFALLVTLISYLFILITILKRHTGKGYQKPLSTCG
SHLIAIFLFYITVIIMYIRPSSSHSMDTDKIASVFYTMIIPMLSPIVYTLRNKDVKNAFM
KVVEKAKYSLDSVF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS T/C Y/C 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN C/T R/R 1000GP (YRI)
11 58,125,620 58,125,620 NS C/T C/Y rs4127353 (DbSNP)
11 58,125,696 58,125,696 NS G/A L/F rs61748315 (DbSNP)
11 58,125,774 58,125,774 NS A/G Y/H rs55810057 (DbSNP)
11 58,125,812 58,125,812 NS G/A T/I rs61741322 (DbSNP)
11 58,125,865 58,125,865 NS C/A R/S rs61744476 (DbSNP)
11 58,126,305 58,126,305 NS A/T L/I rs4939208 (DbSNP)
11 58,126,493 58,126,493 NS T/C N/S rs61741317 (DbSNP)
11 58,358,147 58,358,147 NS T/C Y/C 1000GP (CEU, CHBJPT)
11 58,358,301 58,358,301 NS A/G Y/H 1000GP (CEU)
11 58,358,832 58,358,832 NS A/T L/I 1000GP (CEU, CHBJPT)
11 58,359,006 58,359,006 nonsense SNP G/A Q/* 1000GP (CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Y308C Y257H I244T R226S L80I P24L Q22* N17S % Freq CORP
1 C Y I R I P Q N 62.37 0.624
2 Y Y I R L P Q N 28.57 0.624
3 C H I R I P Q N 4.38 0.624
4 C Y I R I P * N 1.08 1.200
5 C Y T R L P Q N 1.00 0.624
6 C Y I R I P Q S 1.00 0.624
7 C Y I S I P Q N 0.84 0.624
8 C Y I R I L Q N 0.38 0.624
9 C Y I R L P Q N 0.31 0.624
10 Y Y I R I P Q N 0.08 0.624

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5B17.aApr07-unspliced main_exon 3UTR chr11 58,358,125 58,358,128 -
CDS chr11 58,358,128 58,359,069 -