Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5E1P Olfactory Receptor

Gene Symbol OR5E1P1 (View this gene in GeneCards)
Family 5
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-90, OR5E1P, OR11-95, HSTPCR24, HsOR11.5.6P, ORL3492
External Ids HGNC: 8342   GeneBank: AB065769, AF309702, BK004573, BK004582, HSTPCR24P, NG_004124   ORDB: ORL3492   
Build #39 labels OR5E1P
Chromosomal location 11:7,848,700-7,849,632 (+)
Cluster 11@8
Synteny CLIC#25
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5F2P 55.31% 311
OR5M13P 56.31% 309
OR5M5P 53.59% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5E1 88% 309
Mouse Or5e1 88% 309
Rat Or5e1 88% 309
Cow OR5E1 90% 310
Orang OR5G3 54% 310
Horse OR5E1 86% 310
Chimp OR5M13 56% 309

Expression evidences

Source Accession
ESTs FN157866
mRNA AB529251
GNF Atlas2 gnf1h10966_at

Sequence information

Nucleotide sequence ATGACAAAAGGCAATCGTACCACAGTGACCGAATTTGTCCTCATGGGATTCACAGACCGT
CCTGAGCTGCAGCTCCCCCTCTTTGTGGTGTTCCTTGTCATTTATCTCATCACCCTGGTG
GGAAACCTTGGCATGATCCTGCTGATCAGAGCAGACTCGCGGCTCCACACCCCCATGTAC
TACTTCCTCAGTCACCTGGCATTCATTGATCTGTGTTACTCATCTTCTATTGGGCCCAAG
ATGCTGCAAAATGTATTGGTGAAGAAAAAAACCATCTCCTTTTCAGGCTGTTTTGCTCAG
CTGTACTTCTCCGGTGCTTTTGCCACTACAGAATGATTCCTCTTGGCCACAATGCCCTAC
GACCGCTACGTGGCCATCTGCAACCCCCTGATTTACACAGCTATTATGACGCAGCGGGTC
TGCAGGGAGTTAGTGATAGGGGTCTATACCTATGGCTTCCGAAACTCTGTGATACAGACA
GCTCTGACGTTTCAGCTGTCTTTCTGCAACTCCGACGTCATCCACCACTTCTACTGTGCT
GACCCCCCTCTCCTGGCCCTCTCCTGCTCTGACACCCACAACAAAGAAAAGCAGCTCATG
ATCTTCTCTGCAGTAAATCTCACTGGGTCCCTCCTTACCATCTTCATCTCCTACATTTGC
ATCCTCTTTTCCATTATAAAAATCCAGTCTTCCGAGGGCAAGTGCAGAGCATTTTCCACC
CGTGCCTCCCACCTCACTGTCGTCACCATCTTTTATGGCACACTATTTTTCATGTACCTG
CAGCAACCAAAAGCGGGGAATTCATGGAAGCCAAACAAAGTAGTCTCTGTGTTTTATAGT
CTTGTAATTCCCATGCTTAACCCTCTTATCTATCGCCTGAGAAACACAGAAGTAAAGGAT
GCCCTGAAAAAAATGCTAGAGGGCAAAGAGTTA
Conceptual translation MTKGNRTTVTEFVLMGFTDRPELQLPLFVVFLVIYLITLVGNLGMILLIRADSRLHTPMY
YFLSHLAFIDLCYSSSIGPKMLQNVLVKKKTISFSGCFAQLYFSGAFATTEXLLATMPY
DRYVAICNPLIYTAIMTQRVCRELVIGVYTYGFRNSVIQTALTFQLSFCNSDVIHHFYCA
DPPLLALSCSDTHNKEKQLMIFSAVNLTGSLLTIFISYICILFSIIKIQSSEGKCRAFST
RASHLTVVTIFYGTLFFMYLQQPKAGNSWKPNKVVSVFYSLVIPMLNPLIYRLRNTEVKD
ALKKMLEGKEL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP A/G 1000GP (YRI, YRI, YRI)
11 7,848,994 7,848,994 SNP G/T 1000GP (CHBJPT)
11 7,849,123 7,849,123 SNP A/G 1000GP (CEU, CHBJPT)
11 7,849,213 7,849,213 SNP G/A 1000GP (CEU, CHBJPT)
11 7,849,464 7,849,464 SNP A/G 1000GP (CEU, CHBJPT)
11 7,870,442 7,870,442 SNP C/G rs393912 (DbSNP)
11 7,870,631 7,870,631 SNP C/G rs11041601 (DbSNP)
11 7,870,668 7,870,668 SNP A/G rs16932833 (DbSNP)
11 7,870,670 7,870,670 SNP A/G rs61759825 (DbSNP)
11 7,870,760 7,870,760 SNP A/G rs17221305 (DbSNP)
11 7,870,777 7,870,777 SNP T/C rs383999 (DbSNP)
11 7,871,011 7,871,011 SNP A/G rs4758022 (DbSNP)
11 7,871,016 7,871,016 Del(1) -/T rs35679714 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 7,858,828 7,891,030 CopyNumber Variation_35022 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5E1P.aApr07-unspliced main_exon CDS_partial chr11 7,849,051 7,849,562 +