Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5I1 Olfactory Receptor

Gene Symbol OR5I11 (View this gene in GeneCards)
Family 5
Subfamily I
Pseudogene No
CORP pseudogene probability score 0.02 (functional)
Aliases OLF1, OR11-159, HsOR11.11.35, ORL165
External Ids HGNC: 8347   GeneBank: BC069093, BK004518, HSU56420, NM_006637   ORDB: ORL165   
Build #39 labels OR5I1
Chromosomal location 11:55,935,459-55,936,400 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AS1 56.44% 303
OR5D18 57.51% 313
OR9M1P 57.05% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5I1B 90% 314
Dog OR5I1 89% 314
Chimp CONTIG970.38-26808 97% 314
Mouse Or5i1 90% 313
Rat Or5i1 89% 314
Cow OR5I1 90% 314
Cow OR5I1FP 86% 314
Cow OR5I1EP 85% 308
Cow OR5I1GP 80% 313

Expression evidences

Source Accession
mRNA BC069093
GNF Atlas2 208521_at

Sequence information

Nucleotide sequence ATGGAATTTACAGATAGAAACTACACGTTGGTCACTGAGTTTATTCTATTAGGTTTTCCA
ACTCGCCCTGAACTGCAGATTGTCCTGTTCCTCATGTTTCTGACATTGTATGCTATAATT
CTGATAGGGAACATTGGATTGATGCTGTTGATCAGGATTGATCCTCACCTTCAAACCCCC
ATGTATTTTTTCCTTAGCAACCTATCATTTGTAGACCTTTGCTATTTCTCAGACATTGTT
CCCAAAATGCTGGTCAATTTCCTCTCGGAGAACAAATCTATTTCCTATTATGGGTGTGCC
CTGCAGTTTTATTTTTTCTGTACTTTTGCAGATACAGAATCCTTCATCCTGGCCGCCATG
GCCTATGATCGCTATGTCGCCATCTGTAACCCTTTATTGTACACAGTTGTGATGTCTAGG
GGCATCTGTATGCGGTTGATTGTCTTGTCATACCTTGGAGGCAACATGAGTTCCCTGGTT
CACACATCCTTTGCCTTTATTCTGAAATATTGTGACAAAAATGTTATTAATCATTTTTTC
TGTGACCTCCCTCCCCTGCTTAAACTATCCTGCACTGACACAACAATTAATGAGTGGCTC
CTCTCCACATACGGCAGCTCAGTGGAAATCATTTGTTTTATCATCATCATCATCTCCTAC
TTTTTCATTCTTCTCTCAGTCTTAAAGATCCGCTCTTTCAGTGGGAGGAAGAAGACCTTT
TCTACATGCGCCTCTCACCTGACTTCAGTGACGATCTACCAAGGGACTCTCCTCTTTATT
TACTCACGGCCCAGCTACCTGTATTCTCCAAACACTGATAAAATTATCTCAGTGTTCTAC
ACCATTTTCATTCCAGTGCTGAATCCGTTGATTTATAGTTTGAGAAATAAAGATGTAAAG
GATGCAGCTGAGAAAGTTCTAAGATCAAAGGTAGATTCTTCA
Conceptual translation MEFTDRNYTLVTEFILLGFPTRPELQIVLFLMFLTLYAIILIGNIGLMLLIRIDPHLQTP
MYFFLSNLSFVDLCYFSDIVPKMLVNFLSENKSISYYGCALQFYFFCTFADTESFILAAM
AYDRYVAICNPLLYTVVMSRGICMRLIVLSYLGGNMSSLVHTSFAFILKYCDKNVINHFF
CDLPPLLKLSCTDTTINEWLLSTYGSSVEIICFIIIIISYFFILLSVLKIRSFSGRKKTF
STCASHLTSVTIYQGTLLFIYSRPSYLYSPNTDKIISVFYTIFIPVLNPLIYSLRNKDVK
DAAEKVLRSKVDSS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,703,537 55,703,537 NS A/C S/A rs57139368 (DbSNP)
11 55,703,728 55,703,728 NS A/G L/S rs4367963 (DbSNP)
11 55,703,650 55,703,650 NS A/G F/S rs9666086 (DbSNP)
11 55,703,450 55,703,450 NS A/T C/S rs61995927 (DbSNP)
11 55,703,226 55,703,226 NS C/G M/I rs61995928 (DbSNP)
11 55,703,861 55,703,861 NS C/T G/R rs17597625 (DbSNP)
11 55,702,961 55,702,961 NS C/T V/I rs9665861 (DbSNP)
11 55,703,011 55,703,011 NS G/A P/L rs61995929 (DbSNP)
11 55,702,958 55,702,958 NS G/T L/I rs11607055 (DbSNP)
11 55,703,010 55,703,010 SYN A/C P/P rs9665863 (DbSNP)
11 55,703,523 55,703,523 SYN A/G A/A rs11231594 (DbSNP)
11 55,703,766 55,703,766 SYN A/G Y/Y rs17597589 (DbSNP)
11 55,703,247 55,703,247 SYN A/G I/I rs4465383 (DbSNP)
11 55,936,385 55,936,385 NS T/C R/G 1000GP (CEU)
11 55,935,771 55,935,771 SYN G/A I/I 1000GP (CEU, CHBJPT)
11 55,935,485 55,935,485 NS C/T V/I 1000GP (CEU)
11 55,935,535 55,935,535 NS G/A P/L 1000GP (CEU)
11 55,935,534 55,935,534 SYN C/A P/P 1000GP (CEU)
11 55,936,174 55,936,174 NS A/G F/S 1000GP (CEU)
11 55,936,252 55,936,252 NS A/G L/S 1000GP (CEU, CHBJPT)
11 55,936,290 55,936,290 SYN A/G Y/Y 1000GP (CEU)
11 100 -100 NS C/T V/I 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A I/I 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 55,689,863 55,849,156 CopyNumber Variation_2927 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)
11 55,685,799 55,842,512 CopyNumber Variation_9189 (DGV)
11 55,685,556 55,819,544 CopyNumber Variation_29912 (DGV), Variation_48846 (DGV)
11 55,685,556 55,796,170 CopyNumber Variation_48845 (DGV)
11 55,685,556 55,836,620 CopyNumber Variation_48847 (DGV)
11 55,686,728 55,708,815 CopyNumber Variation_53078 (DGV)
11 55,683,109 55,833,490 CopyNumber Variation_85786 (DGV)
11 55,700,935 55,703,976 Deletion #218 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V306I P289L I217M C143S S114A F76S L50S R6G % Freq CORP
1 V P I C S F L R 81.18 0.076
2 V P I C S F S R 10.37 0.076
3 I P I C S S L G 4.22 0.076
4 V L I C S F L R 2.84 0.745
5 V P M S S F L R 0.61 0.076
6 V P I C S S L G 0.31 0.076
7 I P I C S S L R 0.15 0.076
8 I P I C S F L R 0.08 0.076
9 V P M C S F L R 0.08 0.076
10 V P I C A F L R 0.08 0.076
11 V P I C S F L G 0.08 0.076

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5I1.aApr07-unspliced main_exon 3UTR chr11 55,935,456 55,935,459 -
CDS chr11 55,935,459 55,936,400 -