Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR5W2 Olfactory Receptor

Gene Symbol OR5W21 (View this gene in GeneCards)
Family 5
Subfamily W
Pseudogene No
CORP pseudogene probability score 0.01 (functional)
Aliases OR11-155, HsOR11.11.34
External Ids HGNC: 15299   GeneBank: AB065520, AF399355, BK004398, NM_001001960   
Build #39 labels OR5W2P, OR5W3P
Chromosomal location 11:55,913,653-55,914,582 (-)
Cluster 11@56
Synteny CLIC#26
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR5AP2 57.33% 300
OR5AR1 56.68% 307
OR5C1 58.36% 293

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5W2 84% 308
Dog OR5W2B 84% 310
Chimp CONTIG970.39-1494 98% 304
Mouse Or5w8 80% 308
Rat Or8w1 80% 307
Cow OR5W2 82% 307
Cow OR5W2D 83% 310
Cow OR5W2B 80% 310
Cow OR5W2C 81% 292

Expression evidences

Source Accession
GNF Atlas2 gnf1h10904_at

Sequence information

Nucleotide sequence ATGGACTGGGAAAATTGCTCCTCATTAACTGATTTTTTTCTCTTGGGAATTACCAATAAC
CCAGAGATGAAAGTGACCCTATTTGCTGTATTCTTGGCTGTTTATATCATTAATTTCTCA
GCAAATCTTGGAATGATAGTTTTAATCAGAATGGATTACCAACTTCACACACCAATGTAT
TTCTTCCTCAGTCATCTGTCTTTCTGTGATCTCTGCTATTCTACTGCAACTGGGCCCAAG
ATGCTGGTAGATCTACTTGCCAAGAACAAGTCAATACCCTTCTATGGCTGTGCTCTGCAA
TTCTTGGTCTTCTGTATCTTTGCAGATTCTGAGTGTCTACTGCTGTCAGTGATGGCCTTT
GATCGGTACAAGGCCATCATCAACCCCCTGCTCTATACAGTCAACATGTCTAGCAGAGTG
TGCTATCTACTCTTGACTGGGGTTTATCTGGTGGGAATAGCAGATGCTTTGATACATATG
ACACTGGCCTTCCGCCTATGCTTCTGTGGGTCTAATGAGATTAATCATTTCTTCTGTGAT
ATCCCTCCTCTCTTATTACTCTCTCGCTCAGATACACAGGTCAATGAGTTAGTGTTATTC
ACCGTCTTTGGTTTTATTGAACTGAGTACCATTTCAGGAGTTTTCATTTCTTATTGTTAT
ATCATCCTATCAGTCTTGGAGATACACTCTGCTGAGGGGAGGTTCAAAGCTCTCTCTACA
TGCACTTCCCACTTATCTGCGGTTGCAATTTTCCAGGGAACTCTGCTCTTTATGTATTTC
CGGCCAAGTTCTTCCTATTCTCTAGATCAAGATAAAATGACCTCATTGTTTTACACCCTT
GTGGTTCCCATGTTGAACCCCCTGATTTATAGCCTGAGGAACAAGGATGTGAAAGAGGCC
CTGAAAAAACTGAAAAATAAAATTTTATTT
Conceptual translation MDWENCSSLTDFFLLGITNNPEMKVTLFAVFLAVYIINFSANLGMIVLIRMDYQLHTPMY
FFLSHLSFCDLCYSTATGPKMLVDLLAKNKSIPFYGCALQFLVFCIFADSECLLLSVMAF
DRYKAIINPLLYTVNMSSRVCYLLLTGVYLVGIADALIHMTLAFRLCFCGSNEINHFFCD
IPPLLLLSRSDTQVNELVLFTVFGFIELSTISGVFISYCYIILSVLEIHSAEGRFKALST
CTSHLSAVAIFQGTLLFMYFRPSSSYSLDQDKMTSLFYTLVVPMLNPLIYSLRNKDVKEA
LKKLKNKILF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 55,681,638 55,681,638 NS A/C C/G rs12795560 (DbSNP)
11 55,681,416 55,681,416 NS A/G F/L rs17596422 (DbSNP)
11 55,681,580 55,681,580 NS A/G M/T rs17596519 (DbSNP)
11 55,681,130 55,681,130 NS A/T F/Y rs34573569 (DbSNP)
11 55,681,316 55,681,316 NS C/A G/V rs61743020 (DbSNP)
11 55,681,149 55,681,149 NS C/G V/L rs62639688 (DbSNP)
11 55,681,572 55,681,572 NS C/G A/P rs17148883 (DbSNP)
11 55,681,865 55,681,865 NS C/T R/H rs12419022 (DbSNP)
11 55,681,643 55,681,643 NS C/T R/K rs12786096 (DbSNP)
11 55,681,566 55,681,566 NS G/A R/C rs61749302 (DbSNP)
11 55,681,494 55,681,494 NS G/A R/C rs2457239 (DbSNP)
11 55,681,942 55,681,942 NS G/T F/L rs17511797 (DbSNP)
11 55,681,140 55,681,140 NS T/C K/E rs2457240 (DbSNP)
11 55,681,336 55,681,336 SYN A/G C/C rs11231529 (DbSNP)
11 55,681,375 55,681,375 SYN G/T I/I rs17511601 (DbSNP)
11 55,913,860 55,913,860 SYN G/A C/C 1000GP (CEU, CHBJPT)
11 55,914,018 55,914,018 NS G/A R/C 1000GP (CEU, CHBJPT)
11 55,914,090 55,914,090 NS G/A R/C 1000GP (CEU, CHBJPT)
11 55,913,899 55,913,899 SYN T/G I/I 1000GP (CEU)
11 55,913,940 55,913,940 NS A/G F/L 1000GP (CEU)
11 55,914,466 55,914,466 NS G/T F/L 1000GP (CEU)
11 55,914,389 55,914,389 NS T/C H/R 1000GP (CEU, CHBJPT)
11 55,914,104 55,914,104 NS A/G M/T 1000GP (CEU)
11 55,913,673 55,913,673 NS G/C L/V 1000GP (CEU)
11 55,913,654 55,913,654 NS A/T F/Y 1000GP (CEU, CHBJPT)
11 55,913,722 55,913,722 SYN G/A P/P 1000GP (CHBJPT)
11 55,914,178 55,914,178 NS G/T N/K 1000GP (CHBJPT)
11 55,914,523 55,914,523 SYN G/A N/N 1000GP (CHBJPT)
11 100 -100 NS A/T F/Y 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A P/P 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 55,153,930 55,816,828 CopyNumber Variation_0308 (DGV)
11 54,835,623 55,879,426 CopyNumber Variation_8690 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

F310Y L304V F215L R189C R165C M160T Y132S H65R F39L % Freq CORP
1 F L F C R M Y H F 74.04 0.022
2 Y L F C C M Y H F 10.45 0.022
3 F L F C R M Y R F 9.75 0.022
4 F V L C R T Y H L 3.99 0.022
5 F L F C R M S H F 0.54 1.000
6 F L F C C M Y H F 0.31 0.022
7 Y L F C R M Y H F 0.15 0.022
8 F V L C R M Y H L 0.15 0.022
9 F L F R C M Y H F 0.15 0.023
10 F V L C R T Y H F 0.15 0.022
11 F L L C R M Y H F 0.08 0.022
12 F V L C R T Y R L 0.08 0.022
13 F L F C R M Y H L 0.08 0.022
14 F V F C R T Y H L 0.08 0.022

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5W2.aApr07-unspliced main_exon 3UTR chr11 55,913,650 55,913,653 -
CDS chr11 55,913,653 55,914,582 -