Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6C3 Olfactory Receptor

Gene Symbol OR6C31 (View this gene in GeneCards)
Family 6
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.08 (functional)
Aliases HSA8, HsOR12.5.12, ORL3819
External Ids HGNC: 15437   GeneBank: AF179770, NM_054104   ORDB: ORL3819   
Build #39 labels OR6C3
Chromosomal location 12:55,331,701-55,332,633 (+)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6C1 74.76% 309
OR6C5P 78.39% 310
OR6C7P 80.39% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6C3 94% 311
Chimp CONTIG802.61-16852 74% 309
Mouse Or6c3 88% 311
Rat Or6c3c 89% 311
Rat Or6c3 89% 311
Rat Or6c3d 89% 311
Cow OR6C3 93% 311
Cow OR6C3J 93% 311
Cow OR6C3KP 90% 311
Cow OR6C3LP 90% 309
Cow OR6C7 83% 310
Cow OR6C7E 82% 310
Cow OR6C7F 82% 310
Cow OR6C7G 84% 310

Expression evidences

Source Accession
mRNA AB463979

Sequence information

Nucleotide sequence ATGAACCACACAATGGTCACAGAGTTTGTCCTCCTGGGCCTTTCTGATGATCCTGACCTT
CAGATTGTGATTTTTCTCTTTTTATTTATCACGTATATATTAAGTGTTACTGGAAACCTG
ACTATCATCACCCTAACCTTTGTGGACTCCCATCTGCAGACACCTATGTATTTCTTCCTC
CGGAACTTCTCTTTCTTAGAAATCTCATTTACAACCGTATGCATCCCCAGATTTCTGGGG
GCAATTATCACCAGGAATAAGACTATTTCCTATAACAACTGTGCAGCCCAACTCTTTTTC
TTTATCTTCATGGGGGTGACTGAATTTTACATTTTAACTGCCATGTCCTATGACCGCTAT
GTTGCCATCTGCAAGCCCCTTCATTACACATCCATCATGAACAGGAAACTCTGCACTCTA
CTTGTGCTGTGTGCCTGGCTAAGTGGGTTTCTGACCATTTTCCCACCCCTTATGCTTCTC
CTCCAGCTGGATTACTGTGCTTCCAACGTCATTGATCACTTTGCATGTGACTATTTTCCC
CTCTTACAACTATCTTGTTCAGATACATGGCTCCTAGAAGTAATTGGTTTTTACTTTGCT
TTGGTTACTTTGCTGTTCACTTTGGCATTAGTGATTTTATCTTACATGTACATTATCAGG
ACCATTTTGAGAATCCCGTCTGCCAGTCAAAGAAAAAAGGCTTTCTCCACTTGTTCTTCT
CACATGATTGTCATTTCCATTTCTTATGGAAGCTGTATATTCATGTATGCTAATCCATCT
GCAAAAGAAAAGGCATCATTGACAAAAGGAATAGCTATTCTCAATACATCTGTTGCCCCC
ATGCTGAACCCCTTCATTTACACTCTGAGAAACCAGCAAGTAAAACAAGCCTTCAAAAAT
GTGGTCCACAAAGTTGTGTTTTATGCAAATCAA
Conceptual translation MNHTMVTEFVLLGLSDDPDLQIVIFLFLFITYILSVTGNLTIITLTFVDSHLQTPMYFFL
RNFSFLEISFTTVCIPRFLGAIITRNKTISYNNCAAQLFFFIFMGVTEFYILTAMSYDRY
VAICKPLHYTSIMNRKLCTLLVLCAWLSGFLTIFPPLMLLLQLDYCASNVIDHFACDYFP
LLQLSCSDTWLLEVIGFYFALVTLLFTLALVILSYMYIIRTILRIPSASQRKKAFSTCSS
HMIVISISYGSCIFMYANPSAKEKASLTKGIAILNTSVAPMLNPFIYTLRNQQVKQAFKN
VVHKVVFYANQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 100 -100 NS C/T S/L 1000GP (YRI, YRI, YRI, YRI)
12 100 -100 SYN C/A T/T 1000GP (YRI)
12 55,331,906 55,331,906 NS C/T S/L 1000GP (CEU)
12 55,331,962 55,331,962 NS A/T T/S 1000GP (CHBJPT)
12 55,332,190 55,332,190 NS G/C D/H 1000GP (CEU)
12 55,725,690 55,725,690 NS T/C L/S rs4318060 (DbSNP)
12 55,725,882 55,725,882 NS C/T T/M rs11835321 (DbSNP)
12 55,725,974 55,725,974 NS G/T D/Y rs73324778 (DbSNP)
12 55,726,184 55,726,184 NS G/T A/S rs11832940 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
12 55,714,876 55,725,690 CopyNumber Variation_1912 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Q53K S69L T88S M133T S148T V194I I219F A234S A297T % Freq CORP
1 Q S T M S V I A A 78.65 0.212
2 Q L T M S V I A A 13.44 0.212
3 Q S T T S V I A A 3.76 0.275
4 Q S S M S V I A A 2.07 0.212
5 Q S T T S V I S A 1.08 0.521
6 Q S T T S V F A A 0.46 0.275
7 Q S T M S I I A A 0.23 0.212
8 Q S T M S V I A T 0.15 0.212
9 Q S T M T V I A A 0.08 0.212
10 K S T M S V I A A 0.08 0.212

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6C3.aApr07-unspliced main_exon CDS chr12 55,331,701 55,332,633 +
3UTR chr12 55,332,633 55,332,636 +