Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6C6 Olfactory Receptor

Gene Symbol OR6C61 (View this gene in GeneCards)
Family 6
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases HsOR12.5.9
External Ids HGNC: 31293   GeneBank: NM_001005493   
Build #39 labels
Chromosomal location 12:55,294,291-55,295,232 (-)
Cluster 12@56
Synteny CLIC#31
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6C70 74.75% 305
OR6C72P 75% 312
OR6C74 70.19% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6C6 90% 312
Chimp CONTIG*********** 99% 314
Mouse Or6c6 88% 312
Mouse Or6c6c 86% 312
Rat Or6c6g 86% 312
Rat Or6c6f 86% 312
Rat Or6c6b 86% 312
Rat Or6c6i 86% 312
Cow OR6C75 71% 305

Sequence information

Nucleotide sequence ATGAAGAACAAATCAATGGAAATAGAGTTCATTCTCCTAGGATTGACAGATGACCCACAG
TTGCAAATTGTGATTTTCCTGTTTCTATTTCTCAACTACACCTTGAGCCTGATGGGGAAC
TTAATCATCATCATCCTCACCCTGCTGGATCCCCGGCTCAAGACGCCAATGTATTTCTTT
CTCCGTAATTTCTCCTTTTTGGAAGTAATATTCACAACAGTGTGTATTCCTAGATTCTTG
ATAACCATTGTGACTAGAGACAAAACCATTTCTTATAATAATTGTGCAACTCAATTATTT
TTTATCCTTTTACCGGGAGTTACTGAGTTTTACCTCCTGGCTGCCATGTCCTATGACCGC
TACGTTGCCATCTGCAAACCACTGCATTATCCAATCATTATGAGCAGCAAAGTCTGCTAC
CAACTTGTACTTAGCTCTTGGGTAACTGGATTCTTAATCATATTTCCCCCATTGGTCATG
GGACTCAAGCTGGATTTTTGTGCTTCCAAAACTATTGACCACTTTATGTGTGAAACTTCT
CCTATTCTGCAGATCTCCTGCACAGATACCCATGTCCTAGAATTGATGTCTTTTACCTTA
GCTGTGGTGACACTTGTGGTCACACTGGTATTAGTGATTCTCTCTTACACTTGCATTATT
AAGACCATTCTGAAATTCTCTTCTGCACAGCAAAGGAACAAAGCATTTTCCACCTGTACT
TCCCACATGATTGTTGTCTCCATGACATACGGTAGCTGTATCTTTATGTATATTAAACCA
TCTGCAAAAGAAAGAGTGACTGTATCCAAAGGTGTAGCTTTGCTCTATACCTCAATTGCC
CCTTTACTAAATCCCTTCATTTATACTCTCAGAAACCAGCAGGTGAAAGAAGTCTTCTGG
GATGTATTACAAAAGAATTTGTGTTTTTCTAAAAGACCATTT
Conceptual translation MKNKSMEIEFILLGLTDDPQLQIVIFLFLFLNYTLSLMGNLIIIILTLLDPRLKTPMYFF
LRNFSFLEVIFTTVCIPRFLITIVTRDKTISYNNCATQLFFILLPGVTEFYLLAAMSYDR
YVAICKPLHYPIIMSSKVCYQLVLSSWVTGFLIIFPPLVMGLKLDFCASKTIDHFMCETS
PILQISCTDTHVLELMSFTLAVVTLVVTLVLVILSYTCIIKTILKFSSAQQRNKAFSTCT
SHMIVVSMTYGSCIFMYIKPSAKERVTVSKGVALLYTSIAPLLNPFIYTLRNQQVKEVFW
DVLQKNLCFSKRPF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 100 -100 nonsense SNP A/T L/* 1000GP (YRI)
12 100 -100 NS G/A S/F 1000GP (YRI, YRI, YRI, YRI)
12 100 -100 SYN G/A Y/Y 1000GP (YRI, YRI)
12 55,294,483 55,294,483 SYN G/A Y/Y 1000GP (CEU, CHBJPT)
12 55,295,033 55,295,033 NS A/G L/S 1000GP (CHBJPT)
12 55,295,110 55,295,110 NS T/G L/F 1000GP (CEU)
12 55,688,267 55,688,267 SYN A/G Y/Y rs7308594 (DbSNP)
12 55,688,448 55,688,448 NS A/G I/T rs11171402 (DbSNP)
12 55,688,815 55,688,814 Ins(1) -/C rs35212493 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S269P S227F L200* T190I T188R P105L L67S L41F L41S Q22P % Freq CORP
1 S S L T T P L L L Q 88.63 0.131
2 S S L I T P L L L Q 4.45 0.131
3 S S L T R P L L L Q 2.07 0.131
4 S S L T R L L L L P 1.23 0.131
5 S S L T T P L L S Q 1.23 0.131
6 S S L T T P S L L Q 0.69 0.131
7 S S * T T P L L L Q 0.54 1.200
8 S F L I T P L L L Q 0.46 0.131
9 S S L T T P L F L Q 0.38 0.131
10 P S L T T P L L L Q 0.23 0.131
11 S S * T R P L L L Q 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6C6.aApr07-unspliced main_exon 3UTR chr12 55,294,288 55,294,291 -
CDS chr12 55,294,291 55,295,232 -