Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR6Y1 Olfactory Receptor

Gene Symbol OR6Y11 (View this gene in GeneCards)
Family 6
Subfamily Y
Pseudogene No
CORP pseudogene probability score 0.05 (functional)
Aliases OR1-11, HsOR1.4.7, ORL3002
External Ids HGNC: 14823   GeneBank: AB065638, BK004192, NM_001005189   ORDB: ORL3002   
Build #39 labels OR6Y1, OR6Y2
Chromosomal location 1:158,547,131-158,548,105 (-)
Cluster 1@159a
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR6A2 57.56% 311
OR6B1 54.52% 310
OR6P1 59.6% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR6Y1P 90% 301
Chimp CONTIG705.24-33474 96% 325
Mouse Or6y1 87% 320
Rat Or6y1 87% 325
Cow OR6Y1 85% 322

Sequence information

Nucleotide sequence ATGACCACCATAATTCTGGAAGTAGATAATCATACAGTGACAACACGTTTCATTCTTCTG
GGGTTTCCAACACGACCAGCCTTCCAGCTTCTCTTTTTCTCCATTTTCCTGGCAACCTAT
CTGCTGACACTGCTGGAGAATCTTCTTATCATCTTAGCTATCCACAGTGATGGGCAGCTG
CATAAGCCCATGTACTTCTTCTTGAGCCACCTCTCCTTCCTGGAGATGTGGTATGTCACA
GTCATCAGCCCCAAGATGCTTGTTGACTTCCTCAGTCATGACAAGAGTATTTCCTTCAAT
GGCTGCATGACTCAACTTTACTTTTTTGTGACCTTTGTCTGCACTGAGTACATCCTTCTT
GCTATCATGGCCTTTGACCGCTATGTAGCCATTTGTAATCCACTACGCTACCCAGTCATC
ATGACCAACCAGCTCTGTGGCACACTGGCTGGAGGATGCTGGTTCTGTGGACTCATGACT
GCCATGATTAAGATGGTTTTTATAGCACAACTTCACTACTGTGGCATGCCTCAGATCAAT
CACTACTTTTGTGATATCTCTCCACTCCTTAACGTCTCCTGTGAGGATGCCTCACAGGCT
GAGATGGTGGACTTCTTCTTGGCCCTCATGGTCATTGCTATTCCTCTTTGTGTTGTGGTG
GCATCCTACGCTGCTATCCTTGCCACCATCCTCAGGATCCCTTCTGCTCAGGGCCGCCAA
AAGGCATTCTCCACCTGTGCCTCCCACCTGACCGTCGTAATTCTCTTCTATTCCATGACA
CTTTTCACCTATGCCCGTCCCAAACTCATGTATGCCTACAATTCCAACAAAGTGGTATCT
GTTCTCTACACTGTCATTGTTCCACTCCTCAACCCCATCATTTACTGTCTGAGGAACCAT
GAAGTAAAGGCAGCCCTCAGAAAGACCATACATTGCAGAGGAAGTGGGCCCCAGGGAAAT
GGGGCTTTCAGTAGT
Conceptual translation MTTIILEVDNHTVTTRFILLGFPTRPAFQLLFFSIFLATYLLTLLENLLIILAIHSDGQL
HKPMYFFLSHLSFLEMWYVTVISPKMLVDFLSHDKSISFNGCMTQLYFFVTFVCTEYILL
AIMAFDRYVAICNPLRYPVIMTNQLCGTLAGGCWFCGLMTAMIKMVFIAQLHYCGMPQIN
HYFCDISPLLNVSCEDASQAEMVDFFLALMVIAIPLCVVVASYAAILATILRIPSAQGRQ
KAFSTCASHLTVVILFYSMTLFTYARPKLMYAYNSNKVVSVLYTVIVPLLNPIIYCLRNH
EVKAALRKTIHCRGSGPQGNGAFSS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS C/A R/L 1000GP (YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN G/A V/V 1000GP (YRI, YRI, YRI, YRI)
1 158,517,041 158,517,041 SYN A/G V/V rs73014208 (DbSNP)
1 158,517,142 158,517,142 NS C/T V/I rs41273491 (DbSNP)
1 158,517,353 158,517,353 SYN A/G H/H rs16840314 (DbSNP)
1 158,517,489 158,517,489 NS C/T R/H rs41273493 (DbSNP)
1 158,517,585 158,517,585 NS A/G I/T rs55665765 (DbSNP)
1 158,517,816 158,517,816 NS C/G G/A rs61820493 (DbSNP)
1 158,517,879 158,517,878 Ins(1) -/C rs35572510 (DbSNP)
1 158,547,352 158,547,352 NS C/T V/I 1000GP (CEU, CHBJPT)
1 158,547,563 158,547,563 SYN G/A H/H 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
1 158,514,921 158,517,995 Deletion #263 (Waszak)
1 158,516,200 158,521,770 CopyNumber Variation_84604 (DGV)
1 158,516,996 158,520,417 CopyNumber Variation_38148 (DGV)
1 158,517,353 158,521,392 CopyNumber Variation_48145 (DGV), Variation_53317 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R266L V252I C174R T142I I118N F109L T104I F90C V13M T2I % Freq CORP
1 R V C T I F T F V T 71.35 0.140
2 R I C T I F T F V T 20.97 0.172
3 R V C T I F I F V T 2.38 0.140
4 R V C T I F T F V I 2.23 0.140
5 L V C T I F T F V T 1.69 0.140
6 R V C I I F T F V T 0.77 0.140
7 R I C T N F T F V T 0.23 0.172
8 R V R T I F T F V T 0.15 0.140
9 R V C T I L T F V T 0.08 0.140
10 R V C T I F T C V T 0.08 0.140
11 R V C T I F T F M T 0.08 0.140

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR6Y1.aApr07-unspliced main_exon 3UTR chr1 158,547,128 158,547,131 -
CDS chr1 158,547,131 158,548,105 -